Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LMH8

Protein Details
Accession A0A4S8LMH8   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
132-153SIGHSRKTYRLNKGRKPQMETKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
Amino Acid Sequences MSRTPNPRLETLNILQVNLHKSKTAQLDIANEHKHNKLSDTFNIICVQEPYINSIGNIYQGNRWTTIYPTDKFTREADPTRSVILVNKRLNTDAWTQIDVHNTKDITAVRIKGIKGEIDIYCIYNDCTHSESIGHSRKTYRLNKGRKPQMETKTEKCYGAVTSTGIIQTGNQRKTSTSSRKMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.33
4 0.35
5 0.3
6 0.29
7 0.21
8 0.21
9 0.27
10 0.32
11 0.31
12 0.28
13 0.28
14 0.32
15 0.36
16 0.42
17 0.4
18 0.35
19 0.36
20 0.36
21 0.36
22 0.32
23 0.31
24 0.3
25 0.31
26 0.33
27 0.37
28 0.35
29 0.34
30 0.35
31 0.32
32 0.27
33 0.22
34 0.21
35 0.15
36 0.15
37 0.17
38 0.16
39 0.16
40 0.15
41 0.15
42 0.13
43 0.13
44 0.14
45 0.11
46 0.12
47 0.14
48 0.16
49 0.16
50 0.17
51 0.15
52 0.16
53 0.22
54 0.24
55 0.23
56 0.26
57 0.29
58 0.29
59 0.3
60 0.31
61 0.29
62 0.28
63 0.31
64 0.31
65 0.31
66 0.3
67 0.28
68 0.27
69 0.22
70 0.22
71 0.24
72 0.28
73 0.27
74 0.28
75 0.28
76 0.28
77 0.28
78 0.27
79 0.24
80 0.2
81 0.19
82 0.18
83 0.18
84 0.19
85 0.23
86 0.21
87 0.2
88 0.18
89 0.16
90 0.15
91 0.18
92 0.17
93 0.14
94 0.16
95 0.16
96 0.15
97 0.18
98 0.18
99 0.17
100 0.18
101 0.16
102 0.14
103 0.17
104 0.15
105 0.15
106 0.16
107 0.14
108 0.13
109 0.13
110 0.13
111 0.11
112 0.12
113 0.11
114 0.12
115 0.12
116 0.12
117 0.12
118 0.14
119 0.21
120 0.27
121 0.27
122 0.27
123 0.29
124 0.34
125 0.43
126 0.49
127 0.51
128 0.54
129 0.63
130 0.71
131 0.79
132 0.84
133 0.81
134 0.81
135 0.8
136 0.78
137 0.78
138 0.75
139 0.71
140 0.69
141 0.65
142 0.58
143 0.49
144 0.42
145 0.35
146 0.3
147 0.25
148 0.17
149 0.15
150 0.16
151 0.16
152 0.14
153 0.12
154 0.11
155 0.19
156 0.27
157 0.3
158 0.31
159 0.32
160 0.34
161 0.4
162 0.49
163 0.5