Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8KPU1

Protein Details
Accession A0A4S8KPU1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-90FFSSQKSLKKHKCTESVRKRWKQTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 13.666, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences CLEPTCKRHFLSEYTRRVHMQTHVPKGPFPCTKGCSETFSRQHDRFRHEVTKHGYKSKWTCQSCSGFFSSQKSLKKHKCTESVRKRWKQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.54
4 0.51
5 0.47
6 0.41
7 0.42
8 0.42
9 0.47
10 0.49
11 0.48
12 0.49
13 0.48
14 0.51
15 0.44
16 0.38
17 0.36
18 0.33
19 0.36
20 0.37
21 0.36
22 0.34
23 0.35
24 0.4
25 0.4
26 0.44
27 0.48
28 0.46
29 0.51
30 0.51
31 0.51
32 0.47
33 0.47
34 0.48
35 0.42
36 0.47
37 0.46
38 0.51
39 0.48
40 0.49
41 0.45
42 0.44
43 0.49
44 0.52
45 0.55
46 0.48
47 0.48
48 0.5
49 0.55
50 0.5
51 0.47
52 0.42
53 0.35
54 0.35
55 0.37
56 0.37
57 0.37
58 0.42
59 0.44
60 0.51
61 0.58
62 0.66
63 0.7
64 0.72
65 0.76
66 0.79
67 0.84
68 0.85
69 0.87
70 0.88