Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8L9V5

Protein Details
Accession A0A4S8L9V5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-34MLNSRLCSKKKRRYTLMGLATHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, cyto 7.5, cyto_nucl 4.5, mito 3, extr 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007941  DUF726  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF05277  DUF726  
Amino Acid Sequences EEKGGATEEEAKDMLNSRLCSKKKRRYTLMGLATLGGGLVISLSAGLLAPVIGLGLETAFSTIGISCATCFLASTGGAAVITTGGVLTGSGIAVKGMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.21
4 0.23
5 0.32
6 0.36
7 0.45
8 0.54
9 0.6
10 0.66
11 0.74
12 0.77
13 0.76
14 0.81
15 0.81
16 0.77
17 0.68
18 0.58
19 0.48
20 0.4
21 0.31
22 0.22
23 0.12
24 0.05
25 0.02
26 0.02
27 0.02
28 0.01
29 0.01
30 0.01
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.06
56 0.05
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.05
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.04
77 0.04
78 0.04