Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8L587

Protein Details
Accession A0A4S8L587    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
13-32VSRPKGAKWKKAQTGRHGRVBasic
NLS Segment(s)
PositionSequence
15-30RPKGAKWKKAQTGRHG
Subcellular Location(s) mito 12, nucl 10, pero 3
Family & Domain DBs
Amino Acid Sequences MTSTKEVKDLAEVSRPKGAKWKKAQTGRHGRVIQKRHSWVNWHHPLLWYHITKSAPLYHFSAHLLPKALQQENPELF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.3
4 0.38
5 0.42
6 0.43
7 0.52
8 0.59
9 0.61
10 0.7
11 0.77
12 0.77
13 0.82
14 0.77
15 0.76
16 0.7
17 0.67
18 0.66
19 0.65
20 0.61
21 0.56
22 0.56
23 0.5
24 0.47
25 0.46
26 0.44
27 0.48
28 0.48
29 0.43
30 0.4
31 0.39
32 0.39
33 0.39
34 0.39
35 0.3
36 0.24
37 0.27
38 0.26
39 0.24
40 0.26
41 0.27
42 0.22
43 0.24
44 0.25
45 0.21
46 0.22
47 0.24
48 0.26
49 0.21
50 0.22
51 0.22
52 0.21
53 0.25
54 0.31
55 0.31
56 0.29
57 0.31