Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MQR1

Protein Details
Accession A0A4S8MQR1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-42TVLDKAKRLKGEKEKKEQIKQDRIQKEKBasic
NLS Segment(s)
PositionSequence
20-31AKRLKGEKEKKE
Subcellular Location(s) nucl 13.5cyto_nucl 13.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044059  Csn1/TTC4_wheel  
Gene Ontology GO:0051879  F:Hsp90 protein binding  
Pfam View protein in Pfam  
PF18972  Wheel  
CDD cd21377  CTWD_Cns1-like  
Amino Acid Sequences MRCLEFEPTNRGVDTVLDKAKRLKGEKEKKEQIKQDRIQKEKEAQTRLNRSFQERNIVVVPNPSGSQNPYSPHFDPEDPTQSSLIIPVFFLYPQYATSDVSPEFVEDTPFAAHLEIMFPPKSAPPEWDTKHEYVDGNLVIYAMTKQKRLLKVGKKMSLRDVCSAAKAKEGEPRDGLELKDGCLTFVVLPKGAAEKKWVEDFKQTRDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.28
4 0.27
5 0.29
6 0.34
7 0.39
8 0.43
9 0.44
10 0.47
11 0.52
12 0.62
13 0.7
14 0.75
15 0.8
16 0.82
17 0.87
18 0.86
19 0.85
20 0.85
21 0.82
22 0.82
23 0.81
24 0.77
25 0.73
26 0.7
27 0.68
28 0.66
29 0.67
30 0.63
31 0.6
32 0.64
33 0.69
34 0.67
35 0.65
36 0.59
37 0.58
38 0.58
39 0.54
40 0.54
41 0.44
42 0.43
43 0.38
44 0.37
45 0.31
46 0.26
47 0.24
48 0.16
49 0.16
50 0.14
51 0.13
52 0.14
53 0.17
54 0.16
55 0.18
56 0.2
57 0.26
58 0.26
59 0.27
60 0.28
61 0.25
62 0.26
63 0.28
64 0.31
65 0.26
66 0.26
67 0.23
68 0.21
69 0.2
70 0.18
71 0.14
72 0.08
73 0.07
74 0.06
75 0.06
76 0.06
77 0.07
78 0.06
79 0.05
80 0.06
81 0.07
82 0.08
83 0.08
84 0.08
85 0.1
86 0.1
87 0.1
88 0.1
89 0.08
90 0.09
91 0.08
92 0.09
93 0.07
94 0.08
95 0.07
96 0.07
97 0.07
98 0.06
99 0.05
100 0.05
101 0.06
102 0.06
103 0.08
104 0.08
105 0.08
106 0.08
107 0.1
108 0.12
109 0.12
110 0.14
111 0.14
112 0.23
113 0.25
114 0.3
115 0.34
116 0.32
117 0.33
118 0.32
119 0.3
120 0.22
121 0.23
122 0.17
123 0.12
124 0.11
125 0.1
126 0.08
127 0.08
128 0.08
129 0.11
130 0.12
131 0.13
132 0.18
133 0.24
134 0.29
135 0.34
136 0.43
137 0.46
138 0.55
139 0.63
140 0.67
141 0.65
142 0.63
143 0.66
144 0.64
145 0.58
146 0.51
147 0.47
148 0.4
149 0.4
150 0.42
151 0.33
152 0.31
153 0.29
154 0.27
155 0.3
156 0.33
157 0.32
158 0.3
159 0.31
160 0.3
161 0.31
162 0.3
163 0.3
164 0.27
165 0.24
166 0.27
167 0.25
168 0.21
169 0.19
170 0.2
171 0.15
172 0.19
173 0.2
174 0.15
175 0.15
176 0.16
177 0.22
178 0.23
179 0.22
180 0.23
181 0.25
182 0.29
183 0.38
184 0.39
185 0.36
186 0.45
187 0.5