Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MM03

Protein Details
Accession A0A4S8MM03   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
138-161NKLIRDREYSKKRRETLKLRQSAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015418  Eaf6  
Gene Ontology GO:0035267  C:NuA4 histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006325  P:chromatin organization  
GO:0006281  P:DNA repair  
GO:0016573  P:histone acetylation  
Pfam View protein in Pfam  
PF09340  NuA4  
Amino Acid Sequences MTDIEDDKVRHEALKRELVGALQKKRAMDKKLAHLEYQIFNLEQTYLNDTTAHSGGNLIQGFENYLKNQTTGRRRVETAENDRIFSNSSLTYQKSLDLMAEEEGTTTEDGSKQATSGMTTIALPPATRTTEPPPPNQNKLIRDREYSKKRRETLKLRQSAGTISDDETIPTSSRRATKRARVVDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.39
4 0.39
5 0.37
6 0.42
7 0.42
8 0.41
9 0.38
10 0.4
11 0.4
12 0.48
13 0.54
14 0.5
15 0.51
16 0.52
17 0.56
18 0.64
19 0.64
20 0.57
21 0.52
22 0.51
23 0.44
24 0.39
25 0.3
26 0.2
27 0.18
28 0.18
29 0.15
30 0.13
31 0.12
32 0.15
33 0.14
34 0.15
35 0.15
36 0.15
37 0.17
38 0.16
39 0.14
40 0.09
41 0.09
42 0.09
43 0.13
44 0.13
45 0.11
46 0.1
47 0.1
48 0.12
49 0.13
50 0.14
51 0.1
52 0.13
53 0.12
54 0.13
55 0.16
56 0.22
57 0.29
58 0.35
59 0.4
60 0.4
61 0.4
62 0.43
63 0.47
64 0.48
65 0.47
66 0.49
67 0.44
68 0.42
69 0.41
70 0.38
71 0.33
72 0.25
73 0.19
74 0.09
75 0.11
76 0.12
77 0.13
78 0.14
79 0.13
80 0.13
81 0.12
82 0.11
83 0.09
84 0.08
85 0.08
86 0.07
87 0.07
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.06
97 0.07
98 0.07
99 0.06
100 0.07
101 0.07
102 0.08
103 0.07
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.08
110 0.07
111 0.08
112 0.1
113 0.12
114 0.13
115 0.16
116 0.2
117 0.29
118 0.32
119 0.37
120 0.45
121 0.49
122 0.53
123 0.57
124 0.59
125 0.57
126 0.63
127 0.65
128 0.59
129 0.59
130 0.6
131 0.63
132 0.67
133 0.7
134 0.71
135 0.71
136 0.74
137 0.77
138 0.81
139 0.81
140 0.81
141 0.82
142 0.8
143 0.74
144 0.7
145 0.62
146 0.54
147 0.46
148 0.38
149 0.28
150 0.22
151 0.21
152 0.18
153 0.18
154 0.17
155 0.16
156 0.14
157 0.14
158 0.15
159 0.18
160 0.26
161 0.29
162 0.36
163 0.44
164 0.53
165 0.62
166 0.7