Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V6T513

Protein Details
Accession A0A4V6T513    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-33RLLRIPRKIGEKFRRSRSPSPQPSSFHydrophilic
NLS Segment(s)
PositionSequence
9-24LLRIPRKIGEKFRRSR
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSNKKESRLLRIPRKIGEKFRRSRSPSPQPSSFQPSTPQPSLPTNMYEELGGLSISPPAPQTTGQQIRKGAGTAYAGLKQVAQALSDFSDVFPPLQTAVKIFLKIDELVDVRDLLRKLQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.75
4 0.75
5 0.74
6 0.74
7 0.78
8 0.81
9 0.8
10 0.82
11 0.81
12 0.82
13 0.82
14 0.81
15 0.77
16 0.71
17 0.69
18 0.69
19 0.59
20 0.5
21 0.43
22 0.42
23 0.43
24 0.41
25 0.36
26 0.3
27 0.32
28 0.34
29 0.31
30 0.26
31 0.22
32 0.21
33 0.2
34 0.17
35 0.14
36 0.11
37 0.1
38 0.08
39 0.05
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.07
48 0.09
49 0.16
50 0.25
51 0.27
52 0.3
53 0.31
54 0.31
55 0.3
56 0.29
57 0.21
58 0.14
59 0.12
60 0.11
61 0.12
62 0.13
63 0.12
64 0.12
65 0.12
66 0.1
67 0.12
68 0.11
69 0.09
70 0.08
71 0.09
72 0.1
73 0.1
74 0.1
75 0.08
76 0.1
77 0.1
78 0.1
79 0.09
80 0.09
81 0.09
82 0.11
83 0.11
84 0.1
85 0.16
86 0.18
87 0.18
88 0.18
89 0.18
90 0.19
91 0.19
92 0.19
93 0.17
94 0.16
95 0.16
96 0.17
97 0.16
98 0.14
99 0.19
100 0.18