Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KM44

Protein Details
Accession A0A4S8KM44   
Localization Confidence High
Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-31QDTTNQPEKRRPGWPRKDDSGRNQATHydrophilic
306-357LKDNSAKRDQTKTRKRKAIQERKERKRQEREAKKKAQQNRRRLRRVMQFEEEBasic
NLS Segment(s)
PositionSequence
315-350QTKTRKRKAIQERKERKRQEREAKKKAQQNRRRLRR
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MPTPFQDTTNQPEKRRPGWPRKDDSGRNQATAGSTDMAAVLARLQQLEAAAASRDSENALLRAELAAARHTPAQEPTGQGIRDSSTGNRNTSRDGNRHVPATDLFNDNHDDHDDPPTSSAQRRHAEDSNDATSARANKRQRLQRLADERHANSGHTMSSTGGSQEPVAHRHDRADSISGRTNTATSVSEKNEVRVPKPKGQAGKDYSLSSKMGLSKSKKALIQYNTLLRNMRDAVSESRIPWQNEWANIPAADKAMLFAMRERDPFLKRFENDWASEAMVRQYLKNKCKRNYQQGTLQVAEKYEYLKDNSAKRDQTKTRKRKAIQERKERKRQEREAKKKAQQNRRRLRRVMQFEEEEGEPEFVEGSSRDGDQSGGQDDIVPEEVSEEPVKEPQCEEEDDNGAGMQGDGSSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.7
4 0.71
5 0.75
6 0.82
7 0.82
8 0.84
9 0.88
10 0.87
11 0.85
12 0.85
13 0.78
14 0.7
15 0.61
16 0.53
17 0.45
18 0.38
19 0.3
20 0.2
21 0.16
22 0.14
23 0.14
24 0.12
25 0.1
26 0.08
27 0.07
28 0.08
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.1
35 0.09
36 0.08
37 0.08
38 0.08
39 0.09
40 0.09
41 0.09
42 0.09
43 0.11
44 0.12
45 0.12
46 0.13
47 0.12
48 0.12
49 0.12
50 0.11
51 0.1
52 0.09
53 0.11
54 0.11
55 0.12
56 0.14
57 0.15
58 0.16
59 0.18
60 0.2
61 0.2
62 0.21
63 0.23
64 0.27
65 0.26
66 0.24
67 0.23
68 0.22
69 0.21
70 0.2
71 0.2
72 0.23
73 0.26
74 0.3
75 0.34
76 0.33
77 0.36
78 0.42
79 0.46
80 0.44
81 0.47
82 0.5
83 0.48
84 0.49
85 0.45
86 0.39
87 0.33
88 0.33
89 0.29
90 0.25
91 0.22
92 0.21
93 0.25
94 0.23
95 0.23
96 0.2
97 0.18
98 0.16
99 0.21
100 0.21
101 0.17
102 0.19
103 0.2
104 0.21
105 0.24
106 0.28
107 0.32
108 0.35
109 0.39
110 0.42
111 0.45
112 0.46
113 0.45
114 0.45
115 0.39
116 0.35
117 0.31
118 0.26
119 0.23
120 0.26
121 0.26
122 0.29
123 0.32
124 0.38
125 0.46
126 0.55
127 0.6
128 0.62
129 0.63
130 0.64
131 0.7
132 0.68
133 0.66
134 0.64
135 0.56
136 0.53
137 0.49
138 0.4
139 0.3
140 0.26
141 0.19
142 0.14
143 0.14
144 0.09
145 0.09
146 0.09
147 0.08
148 0.08
149 0.08
150 0.08
151 0.1
152 0.12
153 0.13
154 0.17
155 0.18
156 0.18
157 0.2
158 0.21
159 0.2
160 0.2
161 0.22
162 0.2
163 0.21
164 0.26
165 0.25
166 0.24
167 0.22
168 0.21
169 0.17
170 0.17
171 0.15
172 0.12
173 0.15
174 0.15
175 0.2
176 0.2
177 0.21
178 0.24
179 0.24
180 0.24
181 0.3
182 0.33
183 0.35
184 0.39
185 0.41
186 0.43
187 0.45
188 0.5
189 0.46
190 0.44
191 0.39
192 0.36
193 0.33
194 0.29
195 0.26
196 0.18
197 0.16
198 0.15
199 0.16
200 0.2
201 0.23
202 0.28
203 0.31
204 0.34
205 0.34
206 0.33
207 0.39
208 0.36
209 0.38
210 0.35
211 0.38
212 0.36
213 0.36
214 0.34
215 0.27
216 0.27
217 0.22
218 0.19
219 0.14
220 0.15
221 0.16
222 0.18
223 0.2
224 0.18
225 0.23
226 0.27
227 0.27
228 0.25
229 0.29
230 0.28
231 0.28
232 0.3
233 0.25
234 0.21
235 0.2
236 0.21
237 0.14
238 0.12
239 0.11
240 0.08
241 0.07
242 0.07
243 0.07
244 0.07
245 0.08
246 0.12
247 0.13
248 0.14
249 0.17
250 0.2
251 0.23
252 0.25
253 0.29
254 0.32
255 0.32
256 0.34
257 0.38
258 0.38
259 0.36
260 0.35
261 0.3
262 0.24
263 0.24
264 0.21
265 0.15
266 0.14
267 0.13
268 0.13
269 0.2
270 0.28
271 0.36
272 0.45
273 0.53
274 0.56
275 0.67
276 0.74
277 0.78
278 0.78
279 0.75
280 0.75
281 0.75
282 0.74
283 0.65
284 0.57
285 0.46
286 0.38
287 0.33
288 0.25
289 0.18
290 0.15
291 0.15
292 0.16
293 0.2
294 0.25
295 0.3
296 0.36
297 0.42
298 0.46
299 0.48
300 0.55
301 0.59
302 0.66
303 0.71
304 0.76
305 0.79
306 0.83
307 0.83
308 0.83
309 0.86
310 0.86
311 0.85
312 0.86
313 0.87
314 0.87
315 0.93
316 0.92
317 0.91
318 0.91
319 0.91
320 0.91
321 0.91
322 0.92
323 0.92
324 0.93
325 0.9
326 0.88
327 0.87
328 0.87
329 0.85
330 0.85
331 0.86
332 0.87
333 0.88
334 0.85
335 0.85
336 0.84
337 0.84
338 0.81
339 0.77
340 0.69
341 0.62
342 0.59
343 0.5
344 0.4
345 0.32
346 0.24
347 0.16
348 0.13
349 0.12
350 0.08
351 0.09
352 0.08
353 0.09
354 0.1
355 0.11
356 0.12
357 0.11
358 0.13
359 0.13
360 0.15
361 0.15
362 0.14
363 0.13
364 0.14
365 0.14
366 0.15
367 0.16
368 0.13
369 0.11
370 0.12
371 0.13
372 0.14
373 0.15
374 0.14
375 0.14
376 0.2
377 0.21
378 0.21
379 0.22
380 0.23
381 0.26
382 0.29
383 0.32
384 0.31
385 0.33
386 0.31
387 0.3
388 0.25
389 0.22
390 0.17
391 0.13
392 0.09
393 0.05