Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8KXN9

Protein Details
Accession A0A4S8KXN9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-76VVKPTGGTKPKPKPRSQFKPTLSGDHydrophilic
NLS Segment(s)
PositionSequence
33-68RIRSKKSNEEPAKYKPRGKVVKPTGGTKPKPKPRSQ
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MASSNTNTKPESTSTSLGGLKELLKKGWNEVVRIRSKKSNEEPAKYKPRGKVVKPTGGTKPKPKPRSQFKPTLSGDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.31
4 0.28
5 0.26
6 0.2
7 0.18
8 0.21
9 0.21
10 0.18
11 0.19
12 0.2
13 0.22
14 0.27
15 0.27
16 0.24
17 0.27
18 0.34
19 0.4
20 0.42
21 0.42
22 0.41
23 0.42
24 0.47
25 0.48
26 0.51
27 0.48
28 0.51
29 0.53
30 0.56
31 0.63
32 0.59
33 0.6
34 0.53
35 0.58
36 0.6
37 0.59
38 0.61
39 0.59
40 0.64
41 0.62
42 0.62
43 0.61
44 0.63
45 0.64
46 0.63
47 0.66
48 0.68
49 0.73
50 0.78
51 0.79
52 0.8
53 0.86
54 0.84
55 0.84
56 0.78
57 0.8