Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8LZ73

Protein Details
Accession A0A4S8LZ73    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-34TTPLVVPPTKPKPKPKPKPNLTHTVLHydrophilic
NLS Segment(s)
PositionSequence
18-26KPKPKPKPK
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MTLSLTTTTTPLVVPPTKPKPKPKPKPNLTHTVLIPNLFQYPHTPYTPQSQTHHTPPPPPPPTHPQQQPPKTPNPPSSPPSPKNSKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.28
3 0.38
4 0.47
5 0.54
6 0.64
7 0.69
8 0.77
9 0.86
10 0.87
11 0.88
12 0.88
13 0.92
14 0.87
15 0.86
16 0.78
17 0.72
18 0.62
19 0.56
20 0.47
21 0.37
22 0.31
23 0.22
24 0.19
25 0.14
26 0.13
27 0.1
28 0.14
29 0.16
30 0.17
31 0.17
32 0.17
33 0.24
34 0.28
35 0.29
36 0.27
37 0.3
38 0.33
39 0.38
40 0.44
41 0.38
42 0.41
43 0.42
44 0.5
45 0.5
46 0.48
47 0.49
48 0.49
49 0.53
50 0.56
51 0.57
52 0.56
53 0.62
54 0.68
55 0.72
56 0.71
57 0.76
58 0.75
59 0.76
60 0.74
61 0.71
62 0.7
63 0.65
64 0.68
65 0.69
66 0.66
67 0.67