Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LC07

Protein Details
Accession A0A4S8LC07   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
320-339KVKPPAPKASSKKRARVEVDHydrophilic
NLS Segment(s)
PositionSequence
203-207KKKRK
321-334VKPPAPKASSKKRA
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MNTPALTPAQKIIQRAQLQARLSSPAPDATASTNELRDSPSSSTPDPFRTLFSSIPNNGAGRSLSSYAQQLKEQYDLDPNASAEVDKYCGLTLEERLLLGFIVNLKHTQILKKTMNKSEDYRIPGALLTSLRSHAFMLLLSPRLVAYRGNIAKATVDAMRELGVSDIPAPHELGKLKIVQKGINDYLTDCRYQIKDKIAGDLKKKRKNRSNVATLTSKIIGEKSVTITLALYRRVSFLRFVAESYPEDFKGDNFWVKADKVVGEWREAAGKDASKLLGFFEFTYKEDCNNYGDPSQSGVIATPSAEIPAHQKVIDEHAAKVKPPAPKASSKKRARVEVDDSDEEEEDLSPEDRQPSIPPSPSATSSGATNMATNIDCGTPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.52
4 0.5
5 0.5
6 0.49
7 0.45
8 0.41
9 0.37
10 0.34
11 0.29
12 0.24
13 0.23
14 0.21
15 0.2
16 0.19
17 0.21
18 0.21
19 0.22
20 0.21
21 0.21
22 0.21
23 0.22
24 0.2
25 0.22
26 0.22
27 0.25
28 0.28
29 0.3
30 0.34
31 0.35
32 0.38
33 0.38
34 0.35
35 0.33
36 0.32
37 0.34
38 0.31
39 0.32
40 0.35
41 0.33
42 0.35
43 0.34
44 0.31
45 0.28
46 0.27
47 0.22
48 0.17
49 0.18
50 0.17
51 0.15
52 0.16
53 0.21
54 0.25
55 0.27
56 0.27
57 0.27
58 0.27
59 0.29
60 0.29
61 0.25
62 0.27
63 0.26
64 0.25
65 0.24
66 0.22
67 0.19
68 0.19
69 0.17
70 0.11
71 0.11
72 0.11
73 0.09
74 0.1
75 0.09
76 0.1
77 0.11
78 0.11
79 0.12
80 0.13
81 0.13
82 0.13
83 0.13
84 0.12
85 0.11
86 0.09
87 0.08
88 0.06
89 0.07
90 0.08
91 0.09
92 0.09
93 0.13
94 0.15
95 0.18
96 0.21
97 0.28
98 0.35
99 0.42
100 0.49
101 0.52
102 0.55
103 0.54
104 0.54
105 0.53
106 0.52
107 0.49
108 0.44
109 0.37
110 0.33
111 0.29
112 0.25
113 0.2
114 0.14
115 0.11
116 0.1
117 0.12
118 0.11
119 0.12
120 0.12
121 0.1
122 0.1
123 0.08
124 0.09
125 0.09
126 0.11
127 0.1
128 0.1
129 0.09
130 0.1
131 0.1
132 0.09
133 0.08
134 0.15
135 0.16
136 0.17
137 0.18
138 0.17
139 0.17
140 0.17
141 0.17
142 0.09
143 0.09
144 0.08
145 0.08
146 0.08
147 0.08
148 0.08
149 0.06
150 0.05
151 0.05
152 0.05
153 0.05
154 0.06
155 0.06
156 0.07
157 0.07
158 0.09
159 0.09
160 0.1
161 0.11
162 0.15
163 0.17
164 0.2
165 0.21
166 0.2
167 0.21
168 0.25
169 0.24
170 0.21
171 0.19
172 0.17
173 0.19
174 0.18
175 0.18
176 0.13
177 0.14
178 0.14
179 0.16
180 0.19
181 0.2
182 0.23
183 0.23
184 0.29
185 0.33
186 0.36
187 0.41
188 0.47
189 0.52
190 0.56
191 0.62
192 0.66
193 0.69
194 0.74
195 0.77
196 0.76
197 0.77
198 0.72
199 0.7
200 0.63
201 0.55
202 0.47
203 0.38
204 0.29
205 0.19
206 0.16
207 0.12
208 0.1
209 0.1
210 0.1
211 0.1
212 0.1
213 0.1
214 0.1
215 0.12
216 0.14
217 0.14
218 0.13
219 0.12
220 0.14
221 0.15
222 0.16
223 0.14
224 0.13
225 0.15
226 0.14
227 0.15
228 0.15
229 0.16
230 0.16
231 0.18
232 0.19
233 0.15
234 0.16
235 0.15
236 0.13
237 0.15
238 0.16
239 0.17
240 0.15
241 0.15
242 0.17
243 0.17
244 0.18
245 0.15
246 0.13
247 0.12
248 0.18
249 0.18
250 0.18
251 0.18
252 0.17
253 0.19
254 0.19
255 0.19
256 0.16
257 0.16
258 0.15
259 0.16
260 0.16
261 0.13
262 0.13
263 0.12
264 0.11
265 0.11
266 0.11
267 0.12
268 0.13
269 0.14
270 0.18
271 0.17
272 0.18
273 0.19
274 0.2
275 0.21
276 0.21
277 0.24
278 0.21
279 0.22
280 0.21
281 0.21
282 0.2
283 0.16
284 0.14
285 0.12
286 0.11
287 0.09
288 0.09
289 0.07
290 0.07
291 0.08
292 0.08
293 0.08
294 0.11
295 0.15
296 0.17
297 0.16
298 0.17
299 0.17
300 0.23
301 0.3
302 0.27
303 0.25
304 0.31
305 0.32
306 0.31
307 0.35
308 0.34
309 0.33
310 0.35
311 0.42
312 0.39
313 0.48
314 0.58
315 0.64
316 0.7
317 0.73
318 0.79
319 0.78
320 0.82
321 0.79
322 0.77
323 0.74
324 0.72
325 0.7
326 0.63
327 0.57
328 0.5
329 0.43
330 0.35
331 0.28
332 0.19
333 0.12
334 0.12
335 0.11
336 0.1
337 0.12
338 0.15
339 0.15
340 0.16
341 0.19
342 0.23
343 0.3
344 0.33
345 0.33
346 0.36
347 0.39
348 0.4
349 0.41
350 0.37
351 0.31
352 0.28
353 0.28
354 0.25
355 0.21
356 0.19
357 0.16
358 0.16
359 0.15
360 0.15
361 0.14