Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N3R4

Protein Details
Accession G9N3R4   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
100-123GSSSRHKHSPSHHHKHKHSASRHKBasic
NLS Segment(s)
PositionSequence
106-123KHSPSHHHKHKHSASRHK
Subcellular Location(s) nucl 18.5, cyto_nucl 15.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034455  CNL1  
Gene Ontology GO:0031083  C:BLOC-1 complex  
Amino Acid Sequences MLDSSSLSALGRYFDRLMAGIEQNIRYLSEQAQMFTQVQYDRAGNIIDGADAEIARYTDILRQLDELEVDFDRIAHIKEIVKGYRSRVETLERDLESSGGSSSRHKHSPSHHHKHKHSASRHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.16
5 0.17
6 0.17
7 0.16
8 0.19
9 0.18
10 0.18
11 0.18
12 0.17
13 0.15
14 0.15
15 0.14
16 0.17
17 0.17
18 0.16
19 0.17
20 0.18
21 0.18
22 0.16
23 0.17
24 0.12
25 0.12
26 0.13
27 0.13
28 0.11
29 0.11
30 0.11
31 0.08
32 0.09
33 0.07
34 0.06
35 0.05
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.06
46 0.1
47 0.1
48 0.1
49 0.1
50 0.11
51 0.11
52 0.11
53 0.09
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.06
63 0.08
64 0.09
65 0.12
66 0.16
67 0.17
68 0.2
69 0.21
70 0.24
71 0.29
72 0.3
73 0.29
74 0.28
75 0.32
76 0.32
77 0.35
78 0.38
79 0.31
80 0.3
81 0.28
82 0.26
83 0.2
84 0.18
85 0.14
86 0.09
87 0.09
88 0.12
89 0.17
90 0.23
91 0.28
92 0.29
93 0.35
94 0.43
95 0.54
96 0.61
97 0.67
98 0.72
99 0.77
100 0.81
101 0.86
102 0.87
103 0.85