Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8L5S1

Protein Details
Accession A0A4S8L5S1   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
169-189IQVPRHKPFHWPPKLPRCRRYBasic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027370  Znf-RING_euk  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13445  zf-RING_UBOX  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MDFETIRPEPLRRVVTYSRKRQLVTSNQARSQVNHSEQQDSQVQQRDSTDELSTPCEDAYGGDSPEKVLAEKITTLEEALKTLRERQNENYKCPICWELLWQPYVLPCGHTVCARCLTKQAVKHLKTVSPSRTCRKMECMLCRGRIVRPPVLCYTLRDVVQSFAVDQGIQVPRHKPFHWPPKLPRCRRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.54
3 0.62
4 0.67
5 0.68
6 0.68
7 0.67
8 0.65
9 0.65
10 0.65
11 0.65
12 0.65
13 0.64
14 0.62
15 0.66
16 0.62
17 0.55
18 0.5
19 0.48
20 0.42
21 0.41
22 0.41
23 0.4
24 0.39
25 0.4
26 0.39
27 0.32
28 0.34
29 0.35
30 0.33
31 0.3
32 0.31
33 0.29
34 0.26
35 0.27
36 0.22
37 0.16
38 0.16
39 0.18
40 0.18
41 0.16
42 0.14
43 0.11
44 0.11
45 0.09
46 0.11
47 0.1
48 0.1
49 0.1
50 0.11
51 0.11
52 0.12
53 0.12
54 0.09
55 0.08
56 0.07
57 0.08
58 0.09
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.1
68 0.09
69 0.17
70 0.2
71 0.22
72 0.25
73 0.31
74 0.41
75 0.43
76 0.46
77 0.48
78 0.45
79 0.42
80 0.41
81 0.36
82 0.26
83 0.22
84 0.23
85 0.19
86 0.21
87 0.21
88 0.19
89 0.18
90 0.17
91 0.19
92 0.14
93 0.1
94 0.08
95 0.1
96 0.11
97 0.13
98 0.14
99 0.14
100 0.21
101 0.21
102 0.2
103 0.22
104 0.26
105 0.29
106 0.32
107 0.39
108 0.42
109 0.43
110 0.48
111 0.48
112 0.46
113 0.46
114 0.48
115 0.46
116 0.45
117 0.49
118 0.51
119 0.56
120 0.56
121 0.54
122 0.55
123 0.55
124 0.54
125 0.56
126 0.58
127 0.55
128 0.55
129 0.56
130 0.51
131 0.46
132 0.45
133 0.43
134 0.41
135 0.38
136 0.4
137 0.39
138 0.42
139 0.39
140 0.36
141 0.37
142 0.35
143 0.33
144 0.3
145 0.27
146 0.24
147 0.25
148 0.22
149 0.16
150 0.13
151 0.13
152 0.11
153 0.1
154 0.15
155 0.18
156 0.2
157 0.23
158 0.26
159 0.32
160 0.38
161 0.39
162 0.42
163 0.47
164 0.57
165 0.64
166 0.69
167 0.73
168 0.79
169 0.9