Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8MAS0

Protein Details
Accession A0A4S8MAS0    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-31KVWAHFYRDKAKYKNNKYNHKAYCKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPGLSKVWAHFYRDKAKYKNNKYNHKAYCKGCVAQAARVVLNEENRALSEGRRTKIRDIPEIEASVVERMSNACGTVVKFGSFELRTLKGQVETLWRYLRNCSYASEAAITQAEQNLGRAEPIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.61
3 0.69
4 0.73
5 0.78
6 0.81
7 0.81
8 0.84
9 0.83
10 0.86
11 0.84
12 0.82
13 0.8
14 0.72
15 0.71
16 0.65
17 0.59
18 0.5
19 0.48
20 0.41
21 0.36
22 0.37
23 0.3
24 0.25
25 0.24
26 0.25
27 0.19
28 0.19
29 0.17
30 0.13
31 0.12
32 0.12
33 0.13
34 0.12
35 0.1
36 0.17
37 0.21
38 0.22
39 0.27
40 0.29
41 0.32
42 0.36
43 0.39
44 0.37
45 0.36
46 0.38
47 0.35
48 0.33
49 0.29
50 0.24
51 0.21
52 0.14
53 0.1
54 0.07
55 0.05
56 0.05
57 0.06
58 0.06
59 0.05
60 0.05
61 0.06
62 0.07
63 0.1
64 0.1
65 0.09
66 0.09
67 0.09
68 0.14
69 0.13
70 0.14
71 0.15
72 0.17
73 0.18
74 0.19
75 0.2
76 0.16
77 0.17
78 0.17
79 0.21
80 0.21
81 0.24
82 0.27
83 0.28
84 0.28
85 0.32
86 0.34
87 0.3
88 0.29
89 0.27
90 0.29
91 0.29
92 0.29
93 0.26
94 0.22
95 0.21
96 0.2
97 0.18
98 0.13
99 0.13
100 0.14
101 0.12
102 0.13
103 0.13
104 0.13