Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LMZ4

Protein Details
Accession E2LMZ4   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-99LAEEVKRQIRREERKKKKEEEFKIAKEBasic
NLS Segment(s)
PositionSequence
79-91RQIRREERKKKKE
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022023  U1snRNP70_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
KEGG mpr:MPER_08170  -  
Pfam View protein in Pfam  
PF12220  U1snRNP70_N  
Amino Acid Sequences MPGTHLLPPNLLKLFAPRPPLPYARPVDKDIDRIRKKDVHGVAEILQRLKDDAADSLANGEAMEEGEEPAFTLAEEVKRQIRREERKKKKEEEFKIAKETYKPADDPEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.35
4 0.31
5 0.34
6 0.39
7 0.43
8 0.39
9 0.42
10 0.44
11 0.44
12 0.46
13 0.45
14 0.46
15 0.44
16 0.49
17 0.49
18 0.54
19 0.51
20 0.49
21 0.52
22 0.5
23 0.5
24 0.51
25 0.47
26 0.4
27 0.36
28 0.36
29 0.33
30 0.31
31 0.31
32 0.23
33 0.18
34 0.14
35 0.14
36 0.12
37 0.09
38 0.07
39 0.06
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.05
48 0.03
49 0.03
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.04
60 0.05
61 0.07
62 0.09
63 0.11
64 0.17
65 0.22
66 0.24
67 0.31
68 0.4
69 0.49
70 0.6
71 0.69
72 0.74
73 0.8
74 0.88
75 0.89
76 0.89
77 0.89
78 0.87
79 0.86
80 0.84
81 0.79
82 0.78
83 0.71
84 0.64
85 0.57
86 0.54
87 0.49
88 0.44
89 0.4