Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LBB0

Protein Details
Accession A0A4S8LBB0   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
99-125QNRELLAKKERERRLRKKRMESAEMISHydrophilic
NLS Segment(s)
PositionSequence
105-117AKKERERRLRKKR
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MPLPHRFDEWDSVFKSRPSRAAEEEELLAEGFSEDEIPAVIERRNTYRRIYRKAMASKQYYQRHRTEILAKAKSKYQSRVSQKSCREAQRRAQQNYRLQNRELLAKKERERRLRKKRMESAEMISEADQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.36
4 0.39
5 0.38
6 0.41
7 0.42
8 0.47
9 0.46
10 0.43
11 0.4
12 0.34
13 0.28
14 0.23
15 0.18
16 0.1
17 0.07
18 0.05
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.05
26 0.06
27 0.07
28 0.09
29 0.11
30 0.17
31 0.21
32 0.23
33 0.28
34 0.35
35 0.43
36 0.48
37 0.52
38 0.5
39 0.55
40 0.61
41 0.62
42 0.6
43 0.57
44 0.56
45 0.6
46 0.64
47 0.61
48 0.58
49 0.54
50 0.51
51 0.47
52 0.44
53 0.4
54 0.4
55 0.42
56 0.43
57 0.41
58 0.39
59 0.41
60 0.44
61 0.42
62 0.4
63 0.39
64 0.43
65 0.5
66 0.59
67 0.62
68 0.65
69 0.65
70 0.67
71 0.66
72 0.67
73 0.64
74 0.61
75 0.65
76 0.65
77 0.71
78 0.7
79 0.71
80 0.7
81 0.72
82 0.75
83 0.75
84 0.69
85 0.6
86 0.59
87 0.52
88 0.53
89 0.49
90 0.45
91 0.43
92 0.48
93 0.54
94 0.59
95 0.67
96 0.68
97 0.75
98 0.8
99 0.84
100 0.87
101 0.9
102 0.91
103 0.92
104 0.91
105 0.87
106 0.81
107 0.76
108 0.71
109 0.62