Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LRW2

Protein Details
Accession A0A4S8LRW2    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MFSRRTHHRHTTTRRSRNPFHRRDRDRVAGBasic
NLS Segment(s)
PositionSequence
46-58RKHAKHELRRMGR
67-82KIKRTLGIRSSPRRHR
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018824  Conidiation-specific_6  
Pfam View protein in Pfam  
PF10346  Con-6  
Amino Acid Sequences MFSRRTHHRHTTTRRSRNPFHRRDRDRVAGGYKAALANPNTTHEGRKHAKHELRRMGRSTHVPLMTKIKRTLGIRSSPRRHRSTRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.87
3 0.87
4 0.88
5 0.88
6 0.87
7 0.87
8 0.87
9 0.84
10 0.84
11 0.83
12 0.79
13 0.72
14 0.65
15 0.57
16 0.49
17 0.42
18 0.34
19 0.26
20 0.19
21 0.16
22 0.15
23 0.12
24 0.12
25 0.12
26 0.14
27 0.17
28 0.17
29 0.19
30 0.17
31 0.24
32 0.26
33 0.3
34 0.31
35 0.37
36 0.42
37 0.48
38 0.56
39 0.59
40 0.62
41 0.62
42 0.62
43 0.56
44 0.54
45 0.52
46 0.47
47 0.44
48 0.39
49 0.36
50 0.36
51 0.43
52 0.43
53 0.43
54 0.4
55 0.37
56 0.39
57 0.4
58 0.46
59 0.42
60 0.47
61 0.52
62 0.61
63 0.67
64 0.72
65 0.78
66 0.78