Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KQF5

Protein Details
Accession A0A4S8KQF5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
150-169QDRNRNRQRGQGRGMSRRRRBasic
NLS Segment(s)
PositionSequence
155-169NRQRGQGRGMSRRRR
Subcellular Location(s) plas 13, mito 4, E.R. 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPSSTRYIFHVQYNLTPDRFVNNTTIGEKRIEYSIGTANENDSEHRSAFSHSNSAGVIEACNLSGLALEVGFGVDVPEVLAVTAVCVDGTGDAKVKEFETVRVTVEGRYGSSCGKKSYWGRGWVAVVVVVKFGFVFVEIRVECRIGTGMQDRNRNRQRGQGRGMSRRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.33
4 0.29
5 0.29
6 0.28
7 0.26
8 0.22
9 0.21
10 0.23
11 0.25
12 0.27
13 0.24
14 0.24
15 0.23
16 0.21
17 0.2
18 0.18
19 0.15
20 0.16
21 0.2
22 0.2
23 0.21
24 0.19
25 0.19
26 0.19
27 0.2
28 0.18
29 0.16
30 0.16
31 0.15
32 0.16
33 0.16
34 0.17
35 0.19
36 0.2
37 0.19
38 0.17
39 0.18
40 0.17
41 0.16
42 0.14
43 0.11
44 0.09
45 0.07
46 0.07
47 0.06
48 0.06
49 0.05
50 0.04
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.02
62 0.03
63 0.02
64 0.02
65 0.02
66 0.02
67 0.03
68 0.02
69 0.02
70 0.03
71 0.03
72 0.02
73 0.02
74 0.03
75 0.03
76 0.04
77 0.04
78 0.05
79 0.06
80 0.06
81 0.07
82 0.07
83 0.1
84 0.09
85 0.11
86 0.13
87 0.14
88 0.15
89 0.16
90 0.16
91 0.14
92 0.15
93 0.13
94 0.11
95 0.11
96 0.11
97 0.12
98 0.16
99 0.17
100 0.18
101 0.18
102 0.25
103 0.28
104 0.37
105 0.41
106 0.43
107 0.43
108 0.43
109 0.44
110 0.37
111 0.33
112 0.25
113 0.19
114 0.14
115 0.12
116 0.09
117 0.08
118 0.07
119 0.07
120 0.05
121 0.05
122 0.06
123 0.05
124 0.12
125 0.12
126 0.14
127 0.15
128 0.16
129 0.14
130 0.15
131 0.16
132 0.1
133 0.15
134 0.19
135 0.26
136 0.32
137 0.41
138 0.44
139 0.54
140 0.62
141 0.65
142 0.61
143 0.63
144 0.65
145 0.66
146 0.69
147 0.67
148 0.68
149 0.72