Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V4HIX7

Protein Details
Accession A0A4V4HIX7   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-49ALNSSRYHRLTKPRRVSQTEKKFKRKERETEWYSCHydrophilic
NLS Segment(s)
PositionSequence
34-40EKKFKRK
114-122RKAIPGDRK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MCFRTARSRKDPFFALNSSRYHRLTKPRRVSQTEKKFKRKERETEWYSCVVDTAKPGVVSVWCNPLGFTRSIPERGLRIAPETKKSKNCDDEPETEAMLDRRGEVRRLKNSETRKAIPGDRKSKRSYSGLEVGPGRCIAEVAVCSILGIRIGRFDLRKPFIPYDQMMVKDGDKHVGSDNDSEGTLETRVMIEEKSVDFKITSLDSLGIAKVLATGKAVNFDVECQAEDIVQKGSSHKTRDIADVKVQCAPLLYERRKTSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.52
3 0.48
4 0.48
5 0.49
6 0.5
7 0.47
8 0.47
9 0.48
10 0.53
11 0.58
12 0.65
13 0.7
14 0.73
15 0.8
16 0.83
17 0.86
18 0.86
19 0.87
20 0.87
21 0.86
22 0.87
23 0.87
24 0.89
25 0.9
26 0.89
27 0.88
28 0.86
29 0.87
30 0.83
31 0.8
32 0.74
33 0.67
34 0.58
35 0.48
36 0.39
37 0.29
38 0.23
39 0.18
40 0.17
41 0.15
42 0.14
43 0.14
44 0.14
45 0.14
46 0.16
47 0.16
48 0.19
49 0.18
50 0.18
51 0.18
52 0.2
53 0.21
54 0.2
55 0.18
56 0.18
57 0.2
58 0.23
59 0.24
60 0.24
61 0.22
62 0.23
63 0.24
64 0.21
65 0.22
66 0.26
67 0.28
68 0.34
69 0.38
70 0.42
71 0.47
72 0.51
73 0.54
74 0.54
75 0.55
76 0.55
77 0.55
78 0.53
79 0.49
80 0.46
81 0.38
82 0.3
83 0.28
84 0.19
85 0.16
86 0.12
87 0.1
88 0.12
89 0.13
90 0.17
91 0.23
92 0.3
93 0.37
94 0.41
95 0.45
96 0.48
97 0.54
98 0.58
99 0.58
100 0.53
101 0.48
102 0.46
103 0.48
104 0.49
105 0.51
106 0.52
107 0.52
108 0.54
109 0.55
110 0.55
111 0.53
112 0.49
113 0.43
114 0.38
115 0.38
116 0.33
117 0.32
118 0.31
119 0.27
120 0.24
121 0.21
122 0.16
123 0.09
124 0.09
125 0.06
126 0.05
127 0.05
128 0.05
129 0.06
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.04
137 0.05
138 0.06
139 0.08
140 0.09
141 0.12
142 0.19
143 0.22
144 0.26
145 0.3
146 0.32
147 0.32
148 0.35
149 0.33
150 0.29
151 0.29
152 0.26
153 0.23
154 0.21
155 0.19
156 0.19
157 0.18
158 0.18
159 0.15
160 0.15
161 0.16
162 0.17
163 0.18
164 0.17
165 0.17
166 0.15
167 0.14
168 0.14
169 0.11
170 0.1
171 0.09
172 0.07
173 0.07
174 0.06
175 0.07
176 0.07
177 0.07
178 0.06
179 0.08
180 0.09
181 0.13
182 0.13
183 0.13
184 0.12
185 0.13
186 0.15
187 0.14
188 0.13
189 0.1
190 0.1
191 0.1
192 0.11
193 0.11
194 0.08
195 0.07
196 0.06
197 0.08
198 0.08
199 0.08
200 0.08
201 0.1
202 0.1
203 0.14
204 0.14
205 0.12
206 0.12
207 0.13
208 0.15
209 0.15
210 0.15
211 0.12
212 0.12
213 0.12
214 0.12
215 0.12
216 0.11
217 0.12
218 0.12
219 0.14
220 0.22
221 0.27
222 0.32
223 0.34
224 0.37
225 0.38
226 0.47
227 0.48
228 0.44
229 0.47
230 0.47
231 0.45
232 0.45
233 0.42
234 0.33
235 0.31
236 0.28
237 0.28
238 0.34
239 0.38
240 0.42