Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MKY3

Protein Details
Accession A0A4S8MKY3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-74CLDRSQRSFSRKKRERKGKKKTRQRRRRRRRRKRQQGPFKDTAGLBasic
NLS Segment(s)
PositionSequence
39-64SRKKRERKGKKKTRQRRRRRRRRKRQ
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences KRKEEERHNGGKRKDRQTTALPVLCTRTVCLDRSQRSFSRKKRERKGKKKTRQRRRRRRRRKRQQGPFKDTAGLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.72
3 0.68
4 0.66
5 0.67
6 0.66
7 0.6
8 0.51
9 0.43
10 0.42
11 0.38
12 0.32
13 0.23
14 0.2
15 0.19
16 0.19
17 0.24
18 0.29
19 0.32
20 0.36
21 0.41
22 0.39
23 0.45
24 0.52
25 0.54
26 0.58
27 0.62
28 0.68
29 0.74
30 0.81
31 0.85
32 0.88
33 0.91
34 0.91
35 0.93
36 0.95
37 0.95
38 0.95
39 0.95
40 0.95
41 0.95
42 0.96
43 0.96
44 0.97
45 0.97
46 0.97
47 0.98
48 0.98
49 0.98
50 0.97
51 0.97
52 0.97
53 0.95
54 0.89
55 0.81