Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KS65

Protein Details
Accession A0A4S8KS65    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-30TLLSNPVTRKEPRRKKRGRWGETVIAGHydrophilic
NLS Segment(s)
PositionSequence
12-22RKEPRRKKRGR
Subcellular Location(s) plas 11, mito 9, E.R. 4, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVPTLLSNPVTRKEPRRKKRGRWGETVIAGAGGVGSVILVLVLSVRCLNIRQRAPIAVTSDNATNPKIHNDMALNSPKRARKRLATTDGDDPISSFSVGISQIRLVLSLLYNEKITFLRERSRTIKNVDGSILDSNLCCPTANGNIIPIPIFPTPTLIPLLVAPLHIMSPVNNFNEPFLHHRTAILLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.77
4 0.83
5 0.89
6 0.93
7 0.94
8 0.9
9 0.88
10 0.86
11 0.82
12 0.73
13 0.64
14 0.52
15 0.41
16 0.33
17 0.23
18 0.15
19 0.06
20 0.04
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.03
30 0.04
31 0.04
32 0.05
33 0.06
34 0.08
35 0.14
36 0.21
37 0.24
38 0.27
39 0.29
40 0.31
41 0.32
42 0.33
43 0.32
44 0.25
45 0.23
46 0.21
47 0.2
48 0.19
49 0.18
50 0.16
51 0.14
52 0.13
53 0.16
54 0.16
55 0.15
56 0.15
57 0.15
58 0.16
59 0.2
60 0.27
61 0.25
62 0.25
63 0.3
64 0.33
65 0.37
66 0.4
67 0.39
68 0.39
69 0.47
70 0.54
71 0.57
72 0.56
73 0.54
74 0.53
75 0.51
76 0.43
77 0.34
78 0.25
79 0.18
80 0.14
81 0.11
82 0.07
83 0.05
84 0.05
85 0.06
86 0.06
87 0.05
88 0.05
89 0.06
90 0.06
91 0.06
92 0.05
93 0.06
94 0.06
95 0.07
96 0.08
97 0.08
98 0.08
99 0.08
100 0.09
101 0.09
102 0.11
103 0.12
104 0.14
105 0.21
106 0.22
107 0.28
108 0.32
109 0.37
110 0.39
111 0.41
112 0.45
113 0.4
114 0.39
115 0.34
116 0.3
117 0.26
118 0.23
119 0.2
120 0.13
121 0.11
122 0.11
123 0.11
124 0.1
125 0.08
126 0.08
127 0.1
128 0.14
129 0.17
130 0.16
131 0.17
132 0.17
133 0.17
134 0.17
135 0.14
136 0.14
137 0.12
138 0.13
139 0.12
140 0.15
141 0.15
142 0.16
143 0.18
144 0.14
145 0.14
146 0.13
147 0.15
148 0.11
149 0.11
150 0.1
151 0.09
152 0.09
153 0.09
154 0.09
155 0.07
156 0.13
157 0.17
158 0.2
159 0.22
160 0.22
161 0.23
162 0.24
163 0.27
164 0.27
165 0.3
166 0.31
167 0.29
168 0.29