Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LSN4

Protein Details
Accession A0A4S8LSN4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-58IGCRQLLKKTREGRRRRKKKEGLIGSSFSHydrophilic
NLS Segment(s)
PositionSequence
37-50KKTREGRRRRKKKE
Subcellular Location(s) mito 12, nucl 7.5, cyto_nucl 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAFGFNKCPSTLQPSRLSICYHFGGRVEGIGCRQLLKKTREGRRRRKKKEGLIGSSFSTGRPIRVPPVLSYFIPDYPFLSVPYLNPKFYKQRSSLYSSSPLSMPVMFDIELEGPTNVTVSLSYGLQVPIPTIPPSSMESLEATSFSGLDPTYNRDRARDRQAVVIEAARARAMVRMGKKVEKAEKLGIAGRFEQVMRDTGGREEDGRIWLYVMREGWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.5
4 0.5
5 0.43
6 0.41
7 0.38
8 0.32
9 0.28
10 0.25
11 0.25
12 0.22
13 0.22
14 0.18
15 0.16
16 0.16
17 0.17
18 0.17
19 0.16
20 0.19
21 0.23
22 0.31
23 0.34
24 0.42
25 0.49
26 0.59
27 0.66
28 0.75
29 0.8
30 0.83
31 0.89
32 0.9
33 0.92
34 0.92
35 0.92
36 0.92
37 0.91
38 0.87
39 0.81
40 0.74
41 0.64
42 0.56
43 0.46
44 0.35
45 0.3
46 0.23
47 0.19
48 0.19
49 0.19
50 0.2
51 0.24
52 0.25
53 0.21
54 0.27
55 0.28
56 0.25
57 0.26
58 0.24
59 0.22
60 0.22
61 0.2
62 0.15
63 0.15
64 0.16
65 0.14
66 0.13
67 0.12
68 0.11
69 0.21
70 0.22
71 0.21
72 0.22
73 0.25
74 0.32
75 0.35
76 0.41
77 0.34
78 0.38
79 0.41
80 0.47
81 0.45
82 0.4
83 0.42
84 0.36
85 0.34
86 0.27
87 0.24
88 0.17
89 0.15
90 0.12
91 0.07
92 0.08
93 0.07
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.05
101 0.05
102 0.05
103 0.04
104 0.04
105 0.03
106 0.04
107 0.05
108 0.04
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.07
117 0.08
118 0.07
119 0.08
120 0.09
121 0.11
122 0.13
123 0.13
124 0.12
125 0.12
126 0.13
127 0.13
128 0.11
129 0.1
130 0.07
131 0.07
132 0.06
133 0.06
134 0.05
135 0.06
136 0.07
137 0.12
138 0.17
139 0.22
140 0.23
141 0.27
142 0.33
143 0.39
144 0.47
145 0.49
146 0.44
147 0.46
148 0.47
149 0.44
150 0.39
151 0.33
152 0.26
153 0.2
154 0.19
155 0.13
156 0.11
157 0.1
158 0.11
159 0.11
160 0.15
161 0.18
162 0.25
163 0.29
164 0.34
165 0.37
166 0.43
167 0.49
168 0.48
169 0.49
170 0.47
171 0.45
172 0.43
173 0.45
174 0.4
175 0.35
176 0.31
177 0.27
178 0.24
179 0.21
180 0.21
181 0.17
182 0.17
183 0.16
184 0.16
185 0.16
186 0.17
187 0.2
188 0.19
189 0.19
190 0.2
191 0.2
192 0.22
193 0.22
194 0.2
195 0.18
196 0.19
197 0.2
198 0.21