Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LLJ8

Protein Details
Accession A0A4S8LLJ8   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-32PTTQMKSKSKSKTPNPQLLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003822  PAH  
IPR036600  PAH_sf  
IPR039774  Sin3-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0003714  F:transcription corepressor activity  
PROSITE View protein in PROSITE  
PS51477  PAH  
Amino Acid Sequences MSSRTTKHSPLNPTTQMKSKSKSKTPNPQLLSSAQSYLSSVQSALSNNPEAYNAFLSIMSDFRDGRISIPTSMHRITTLFLSQSSHYPHLVSGYNLFLPPGYKIEFVDESSEIKGPHETKQTTRTPRFVVPPAPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.63
4 0.6
5 0.6
6 0.6
7 0.61
8 0.64
9 0.7
10 0.72
11 0.76
12 0.79
13 0.83
14 0.78
15 0.72
16 0.66
17 0.59
18 0.52
19 0.42
20 0.34
21 0.25
22 0.2
23 0.18
24 0.16
25 0.14
26 0.11
27 0.09
28 0.09
29 0.1
30 0.11
31 0.11
32 0.12
33 0.13
34 0.13
35 0.13
36 0.13
37 0.11
38 0.12
39 0.12
40 0.09
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.1
51 0.1
52 0.1
53 0.12
54 0.12
55 0.12
56 0.14
57 0.15
58 0.17
59 0.17
60 0.17
61 0.14
62 0.13
63 0.13
64 0.13
65 0.13
66 0.09
67 0.09
68 0.11
69 0.11
70 0.14
71 0.17
72 0.17
73 0.16
74 0.16
75 0.16
76 0.17
77 0.17
78 0.15
79 0.12
80 0.12
81 0.13
82 0.12
83 0.12
84 0.1
85 0.1
86 0.1
87 0.11
88 0.12
89 0.12
90 0.12
91 0.17
92 0.18
93 0.18
94 0.2
95 0.18
96 0.18
97 0.19
98 0.2
99 0.16
100 0.16
101 0.2
102 0.19
103 0.24
104 0.31
105 0.33
106 0.36
107 0.44
108 0.53
109 0.57
110 0.62
111 0.62
112 0.59
113 0.62
114 0.63
115 0.61