Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8LYY4

Protein Details
Accession A0A4S8LYY4    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
61-82GNATIKKLKKQRKKLEGIIRGYHydrophilic
NLS Segment(s)
PositionSequence
66-74KKLKKQRKK
Subcellular Location(s) mito 23, nucl 2.5, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MPHTRKPLALSRHGKNQLSLLRPALFPLPGVQNSTDIPEFARDFYSRKLQEPQEFLKFWSGNATIKKLKKQRKKLEGIIRGYLFFLKWGRDPDPRYSTFIRNLWSGLDFDDMLAEDRAFAIQERQKKGLPVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.58
3 0.58
4 0.54
5 0.5
6 0.47
7 0.4
8 0.35
9 0.33
10 0.33
11 0.28
12 0.21
13 0.17
14 0.17
15 0.18
16 0.17
17 0.19
18 0.18
19 0.18
20 0.18
21 0.21
22 0.18
23 0.14
24 0.13
25 0.14
26 0.15
27 0.14
28 0.16
29 0.13
30 0.15
31 0.18
32 0.27
33 0.25
34 0.27
35 0.32
36 0.35
37 0.39
38 0.42
39 0.44
40 0.4
41 0.39
42 0.37
43 0.37
44 0.32
45 0.26
46 0.25
47 0.22
48 0.2
49 0.22
50 0.25
51 0.25
52 0.27
53 0.35
54 0.39
55 0.48
56 0.54
57 0.64
58 0.7
59 0.74
60 0.79
61 0.81
62 0.82
63 0.81
64 0.74
65 0.68
66 0.58
67 0.49
68 0.42
69 0.33
70 0.22
71 0.16
72 0.14
73 0.11
74 0.13
75 0.16
76 0.2
77 0.26
78 0.3
79 0.36
80 0.41
81 0.41
82 0.44
83 0.44
84 0.45
85 0.44
86 0.43
87 0.38
88 0.32
89 0.31
90 0.27
91 0.24
92 0.2
93 0.15
94 0.15
95 0.12
96 0.11
97 0.11
98 0.1
99 0.11
100 0.11
101 0.1
102 0.08
103 0.08
104 0.08
105 0.08
106 0.08
107 0.14
108 0.19
109 0.27
110 0.33
111 0.37
112 0.39