Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8MDX3

Protein Details
Accession A0A4S8MDX3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-35APSSGGKAAKKKKWSKGKVKDKAQHIVNHydrophilic
NLS Segment(s)
PositionSequence
7-29PAPSSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKTPAPSSGGKAAKKKKWSKGKVKDKAQHIVNVDKATYDRIVKEVPTFRFISQSILIERLKINGSLARLAIKHLEKEGQIKRIVHHSAQLIYTRATAASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.62
4 0.68
5 0.73
6 0.74
7 0.78
8 0.83
9 0.85
10 0.86
11 0.9
12 0.9
13 0.91
14 0.88
15 0.84
16 0.81
17 0.73
18 0.67
19 0.59
20 0.53
21 0.46
22 0.39
23 0.33
24 0.25
25 0.22
26 0.19
27 0.17
28 0.14
29 0.11
30 0.12
31 0.12
32 0.13
33 0.16
34 0.2
35 0.2
36 0.22
37 0.23
38 0.22
39 0.24
40 0.23
41 0.22
42 0.18
43 0.18
44 0.15
45 0.17
46 0.17
47 0.16
48 0.15
49 0.14
50 0.14
51 0.12
52 0.12
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.13
60 0.18
61 0.17
62 0.18
63 0.18
64 0.2
65 0.2
66 0.28
67 0.32
68 0.32
69 0.36
70 0.36
71 0.36
72 0.41
73 0.44
74 0.37
75 0.36
76 0.34
77 0.32
78 0.33
79 0.34
80 0.28
81 0.25
82 0.24
83 0.2