Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8KLQ6

Protein Details
Accession A0A4S8KLQ6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
64-87IIIYQMKKKEKEKEKQHKASPSSLHydrophilic
NLS Segment(s)
PositionSequence
71-77KKEKEKE
Subcellular Location(s) cyto 21, nucl 1, mito 1, plas 1, extr 1, pero 1, E.R. 1, mito_nucl 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPGTGEGATGEGATGVGVGTTGGGIDTVGKGVGAIGNSSDADGVWKPFLIALGVGTIILGIVSIIIYQMKKKEKEKEKQHKASPSSLSNTENA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.02
8 0.02
9 0.02
10 0.02
11 0.03
12 0.03
13 0.03
14 0.04
15 0.04
16 0.04
17 0.03
18 0.04
19 0.05
20 0.04
21 0.04
22 0.04
23 0.05
24 0.05
25 0.06
26 0.05
27 0.04
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.04
53 0.05
54 0.07
55 0.13
56 0.21
57 0.27
58 0.34
59 0.44
60 0.53
61 0.63
62 0.73
63 0.78
64 0.82
65 0.86
66 0.88
67 0.87
68 0.82
69 0.79
70 0.74
71 0.68
72 0.63
73 0.57