Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8LTY8

Protein Details
Accession A0A4S8LTY8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRLRRSRAHHARRDVHRASRBasic
NLS Segment(s)
PositionSequence
6-19RSRAHHARRDVHRA
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRAHHARRDVHRASRTRARTKDLDQIQLIDLDPKNRAKLEAQPIDYETPGLAQHYCVECAKYYETDNALQSHWRSKVHKRRVKQLKEPAYTIEESERAAGLGREGKRSTTTTSLSSVQINADGDMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.79
4 0.77
5 0.73
6 0.7
7 0.7
8 0.71
9 0.71
10 0.69
11 0.66
12 0.64
13 0.63
14 0.65
15 0.6
16 0.57
17 0.48
18 0.45
19 0.39
20 0.34
21 0.29
22 0.24
23 0.21
24 0.16
25 0.19
26 0.19
27 0.2
28 0.2
29 0.21
30 0.18
31 0.25
32 0.33
33 0.36
34 0.36
35 0.35
36 0.36
37 0.36
38 0.33
39 0.26
40 0.16
41 0.1
42 0.09
43 0.08
44 0.07
45 0.06
46 0.09
47 0.09
48 0.11
49 0.1
50 0.11
51 0.1
52 0.12
53 0.13
54 0.11
55 0.11
56 0.12
57 0.14
58 0.15
59 0.16
60 0.15
61 0.14
62 0.15
63 0.15
64 0.18
65 0.19
66 0.21
67 0.24
68 0.34
69 0.44
70 0.53
71 0.6
72 0.59
73 0.68
74 0.75
75 0.79
76 0.79
77 0.79
78 0.78
79 0.74
80 0.71
81 0.63
82 0.56
83 0.48
84 0.39
85 0.31
86 0.21
87 0.18
88 0.18
89 0.14
90 0.1
91 0.1
92 0.09
93 0.09
94 0.15
95 0.16
96 0.21
97 0.22
98 0.24
99 0.27
100 0.29
101 0.32
102 0.3
103 0.32
104 0.29
105 0.32
106 0.32
107 0.31
108 0.3
109 0.26
110 0.21
111 0.21
112 0.2