Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8L669

Protein Details
Accession A0A4S8L669    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
105-124HKDGQKPNEQHKKKPTASRRBasic
NLS Segment(s)
PositionSequence
115-124HKKKPTASRR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MASDLTDVDYTTYESENGWMEIQTVSGGEQEPAAGDENNVTKTQENQYKPYIELLAQKDDFLALARKRINELEDYVKTLEQRVRYLEDLQSNADRGRKNLTDTLHKDGQKPNEQHKKKPTASRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.13
5 0.12
6 0.11
7 0.11
8 0.1
9 0.1
10 0.09
11 0.07
12 0.06
13 0.07
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.07
20 0.08
21 0.07
22 0.07
23 0.09
24 0.1
25 0.12
26 0.12
27 0.12
28 0.11
29 0.14
30 0.21
31 0.27
32 0.28
33 0.3
34 0.33
35 0.34
36 0.34
37 0.32
38 0.26
39 0.2
40 0.24
41 0.22
42 0.24
43 0.22
44 0.21
45 0.19
46 0.18
47 0.17
48 0.11
49 0.14
50 0.09
51 0.14
52 0.15
53 0.16
54 0.17
55 0.19
56 0.19
57 0.16
58 0.18
59 0.2
60 0.2
61 0.22
62 0.21
63 0.21
64 0.19
65 0.2
66 0.2
67 0.16
68 0.18
69 0.18
70 0.21
71 0.22
72 0.24
73 0.25
74 0.25
75 0.25
76 0.25
77 0.24
78 0.22
79 0.22
80 0.24
81 0.22
82 0.2
83 0.26
84 0.25
85 0.28
86 0.32
87 0.34
88 0.39
89 0.43
90 0.49
91 0.49
92 0.49
93 0.5
94 0.52
95 0.57
96 0.56
97 0.58
98 0.61
99 0.65
100 0.69
101 0.74
102 0.77
103 0.79
104 0.77