Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8MVX3

Protein Details
Accession A0A4S8MVX3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-32VKEKAPKKSKSTGGKRKKLTPFNKBasic
NLS Segment(s)
PositionSequence
9-26VKEKAPKKSKSTGGKRKK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MAGTKAAAVKEKAPKKSKSTGGKRKKLTPFNKFMQTEMARLKEDEPDMSHQERFKVATGNWKKAPENPNRAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.66
4 0.69
5 0.7
6 0.74
7 0.76
8 0.79
9 0.82
10 0.81
11 0.82
12 0.82
13 0.81
14 0.79
15 0.77
16 0.74
17 0.7
18 0.73
19 0.64
20 0.55
21 0.53
22 0.45
23 0.39
24 0.35
25 0.31
26 0.23
27 0.23
28 0.23
29 0.18
30 0.18
31 0.16
32 0.15
33 0.18
34 0.22
35 0.24
36 0.25
37 0.23
38 0.24
39 0.25
40 0.24
41 0.21
42 0.21
43 0.2
44 0.29
45 0.35
46 0.41
47 0.45
48 0.48
49 0.48
50 0.51
51 0.6
52 0.59