Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LT15

Protein Details
Accession A0A4S8LT15   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
113-141GKEKDANSSKKKSKTTKGKVRSKRGCTDAHydrophilic
NLS Segment(s)
PositionSequence
98-136AKKNKSKSKTSAEGKGKEKDANSSKKKSKTTKGKVRSKR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036279  5-3_exonuclease_C_sf  
Amino Acid Sequences MTTRLPQPIKGAGPKSAPKLIREHGSLDKLKVEDLRANISKDAEKVSAQEAAAAELASEDEKGEPEEEDELTPTSNVERPCSSDVEMDGNEDGEESAAKKNKSKSKTSAEGKGKEKDANSSKKKSKTTKGKVRSKRGCTDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.51
4 0.47
5 0.43
6 0.46
7 0.47
8 0.45
9 0.42
10 0.41
11 0.4
12 0.44
13 0.43
14 0.38
15 0.37
16 0.32
17 0.31
18 0.28
19 0.25
20 0.22
21 0.22
22 0.28
23 0.27
24 0.28
25 0.27
26 0.27
27 0.26
28 0.23
29 0.24
30 0.18
31 0.15
32 0.15
33 0.15
34 0.16
35 0.14
36 0.15
37 0.12
38 0.12
39 0.12
40 0.1
41 0.08
42 0.06
43 0.06
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.06
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.09
63 0.09
64 0.11
65 0.11
66 0.15
67 0.17
68 0.19
69 0.19
70 0.16
71 0.17
72 0.17
73 0.17
74 0.14
75 0.12
76 0.11
77 0.09
78 0.09
79 0.08
80 0.05
81 0.05
82 0.05
83 0.1
84 0.14
85 0.15
86 0.2
87 0.28
88 0.36
89 0.41
90 0.48
91 0.51
92 0.56
93 0.65
94 0.66
95 0.68
96 0.69
97 0.71
98 0.69
99 0.67
100 0.61
101 0.55
102 0.5
103 0.5
104 0.5
105 0.53
106 0.56
107 0.6
108 0.65
109 0.7
110 0.78
111 0.78
112 0.8
113 0.8
114 0.84
115 0.85
116 0.87
117 0.9
118 0.91
119 0.93
120 0.93
121 0.9