Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9MG54

Protein Details
Accession G9MG54    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
76-96GYDEKKRREIMKKRREAMKRGBasic
NLS Segment(s)
PositionSequence
80-95KKRREIMKKRREAMKR
Subcellular Location(s) extr 9, E.R. 6, golg 4, mito 3, cyto 2, plas 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MKLTFVVYIASLVASVSGAPVSTEEVDAGLFTSLDGVWNSYGYDEKKRRDLIKKGTTEEVDAGLFTSLDGVWNSYGYDEKKRREIMKKRREAMKRGTTEEVDAGLFTSLDGVWNSYGYDEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.07
9 0.07
10 0.08
11 0.07
12 0.08
13 0.08
14 0.07
15 0.07
16 0.05
17 0.04
18 0.04
19 0.05
20 0.04
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.07
28 0.1
29 0.11
30 0.2
31 0.25
32 0.28
33 0.33
34 0.38
35 0.45
36 0.5
37 0.56
38 0.57
39 0.61
40 0.62
41 0.58
42 0.57
43 0.5
44 0.43
45 0.35
46 0.26
47 0.16
48 0.12
49 0.1
50 0.07
51 0.06
52 0.05
53 0.05
54 0.04
55 0.05
56 0.05
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.1
63 0.11
64 0.2
65 0.25
66 0.28
67 0.34
68 0.39
69 0.46
70 0.54
71 0.62
72 0.64
73 0.7
74 0.76
75 0.77
76 0.81
77 0.81
78 0.77
79 0.77
80 0.76
81 0.7
82 0.65
83 0.62
84 0.54
85 0.49
86 0.42
87 0.33
88 0.23
89 0.18
90 0.13
91 0.09
92 0.08
93 0.06
94 0.05
95 0.04
96 0.05
97 0.05
98 0.06
99 0.06
100 0.07
101 0.07
102 0.07