Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8KTP2

Protein Details
Accession A0A4S8KTP2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MDDLKGGPKKRKISREKAFGIBasic
NLS Segment(s)
PositionSequence
7-15GPKKRKISR
Subcellular Location(s) mito 16.5, cyto_mito 11.833, cyto 6, cyto_nucl 5.833, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MDDLKGGPKKRKISREKAFGIAFPGVPYKASTFTKAYRAYELGRQNRIIYKQFMEADREEAGLWSGFVKHVTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.79
4 0.76
5 0.68
6 0.58
7 0.51
8 0.41
9 0.32
10 0.23
11 0.2
12 0.13
13 0.13
14 0.13
15 0.11
16 0.14
17 0.15
18 0.17
19 0.18
20 0.2
21 0.26
22 0.28
23 0.28
24 0.25
25 0.26
26 0.24
27 0.28
28 0.35
29 0.34
30 0.34
31 0.34
32 0.34
33 0.36
34 0.39
35 0.35
36 0.3
37 0.27
38 0.29
39 0.31
40 0.31
41 0.31
42 0.28
43 0.28
44 0.25
45 0.24
46 0.19
47 0.16
48 0.15
49 0.11
50 0.1
51 0.08
52 0.08
53 0.09