Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8MKE4

Protein Details
Accession A0A4S8MKE4    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHKNGIKKPQSNHydrophilic
NLS Segment(s)
PositionSequence
14-54KKAHKNGIKKPQSNRTRSLKGVEPKFRRNARFALIGSHKAR
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHKNGIKKPQSNRTRSLKGVEPKFRRNARFALIGSHKARAAQKAAAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.82
4 0.8
5 0.79
6 0.8
7 0.83
8 0.83
9 0.8
10 0.78
11 0.79
12 0.79
13 0.74
14 0.72
15 0.69
16 0.64
17 0.59
18 0.55
19 0.51
20 0.5
21 0.53
22 0.55
23 0.53
24 0.54
25 0.61
26 0.64
27 0.6
28 0.57
29 0.52
30 0.47
31 0.46
32 0.4
33 0.39
34 0.37
35 0.41
36 0.39
37 0.38
38 0.35
39 0.34
40 0.37
41 0.33
42 0.33
43 0.28
44 0.29