Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KTM0

Protein Details
Accession A0A4S8KTM0   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-53TYQSVTKKSRKGTKRELKKDPKVKSKDFEHydrophilic
NLS Segment(s)
PositionSequence
31-49KKSRKGTKRELKKDPKVKS
Subcellular Location(s) nucl 19, cyto_nucl 14.833, mito_nucl 10.499, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MSDSDEEELSPTPPPSFEVQVRLTTYQSVTKKSRKGTKRELKKDPKVKSKDFEYKFASTSENYVQFLNEILQLFGFCVKAIAAKIFPMTVQVPPTTKSQATDIFCHSKSQATNIESLAEYKKLASKIVEKAPLKPIIVSVDQQEIQKVKLPKATNNGHDTDGSQGRHDGPGALDDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.23
4 0.24
5 0.28
6 0.3
7 0.33
8 0.36
9 0.35
10 0.32
11 0.29
12 0.28
13 0.3
14 0.3
15 0.32
16 0.37
17 0.43
18 0.48
19 0.55
20 0.63
21 0.63
22 0.7
23 0.74
24 0.78
25 0.81
26 0.85
27 0.87
28 0.88
29 0.9
30 0.9
31 0.88
32 0.88
33 0.85
34 0.81
35 0.75
36 0.74
37 0.73
38 0.67
39 0.64
40 0.59
41 0.53
42 0.48
43 0.43
44 0.36
45 0.26
46 0.27
47 0.24
48 0.2
49 0.19
50 0.18
51 0.17
52 0.15
53 0.15
54 0.12
55 0.1
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.06
63 0.04
64 0.04
65 0.04
66 0.05
67 0.06
68 0.07
69 0.06
70 0.06
71 0.07
72 0.06
73 0.06
74 0.07
75 0.08
76 0.08
77 0.09
78 0.1
79 0.1
80 0.12
81 0.15
82 0.15
83 0.14
84 0.14
85 0.16
86 0.21
87 0.22
88 0.23
89 0.25
90 0.27
91 0.27
92 0.28
93 0.25
94 0.23
95 0.21
96 0.23
97 0.25
98 0.22
99 0.23
100 0.22
101 0.23
102 0.19
103 0.21
104 0.18
105 0.12
106 0.11
107 0.1
108 0.14
109 0.14
110 0.15
111 0.16
112 0.2
113 0.25
114 0.31
115 0.39
116 0.36
117 0.39
118 0.44
119 0.45
120 0.4
121 0.34
122 0.3
123 0.26
124 0.27
125 0.24
126 0.2
127 0.21
128 0.22
129 0.22
130 0.24
131 0.21
132 0.2
133 0.25
134 0.26
135 0.25
136 0.31
137 0.33
138 0.36
139 0.44
140 0.51
141 0.52
142 0.53
143 0.53
144 0.48
145 0.45
146 0.4
147 0.37
148 0.36
149 0.3
150 0.26
151 0.25
152 0.25
153 0.26
154 0.26
155 0.21
156 0.15