Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8LJB4

Protein Details
Accession A0A4S8LJB4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
102-123DTISRTLKKRGWTRKKVCDLSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MTGNYRYISSTQKENIFLLSRDLKPVHIARHLRVSVRTVYRVLGYVSEHGDVPRPLRTGRPSLLDALDSLFLESLVERTPDITLFELQEELELKRGIWVGEDTISRTLKKRGWTRKKVCDLSELSYSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.35
4 0.32
5 0.31
6 0.32
7 0.28
8 0.31
9 0.31
10 0.27
11 0.3
12 0.33
13 0.31
14 0.33
15 0.36
16 0.34
17 0.42
18 0.43
19 0.4
20 0.38
21 0.37
22 0.35
23 0.35
24 0.35
25 0.26
26 0.26
27 0.24
28 0.23
29 0.2
30 0.15
31 0.12
32 0.12
33 0.12
34 0.12
35 0.12
36 0.11
37 0.13
38 0.12
39 0.13
40 0.14
41 0.14
42 0.14
43 0.18
44 0.21
45 0.23
46 0.23
47 0.26
48 0.23
49 0.24
50 0.23
51 0.2
52 0.16
53 0.13
54 0.12
55 0.08
56 0.07
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.08
69 0.08
70 0.09
71 0.09
72 0.1
73 0.09
74 0.09
75 0.09
76 0.1
77 0.08
78 0.1
79 0.1
80 0.1
81 0.11
82 0.12
83 0.11
84 0.11
85 0.12
86 0.1
87 0.13
88 0.14
89 0.14
90 0.18
91 0.2
92 0.2
93 0.22
94 0.26
95 0.28
96 0.36
97 0.44
98 0.51
99 0.61
100 0.71
101 0.78
102 0.83
103 0.9
104 0.88
105 0.8
106 0.77
107 0.71
108 0.64