Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8L5V7

Protein Details
Accession A0A4S8L5V7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MFFRSTRKKRLEMKKVSKLEAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR008949  Isoprenoid_synthase_dom_sf  
Amino Acid Sequences MFFRSTRKKRLEMKKVSKLEALAILVDECVAAHQNAVKTLTPNKEALAMYHNWMQGYLAYHIYAERYRLNELGFGVDQCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.78
4 0.7
5 0.59
6 0.5
7 0.41
8 0.31
9 0.21
10 0.16
11 0.13
12 0.1
13 0.09
14 0.07
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.06
21 0.07
22 0.08
23 0.1
24 0.1
25 0.11
26 0.16
27 0.18
28 0.19
29 0.19
30 0.18
31 0.2
32 0.19
33 0.18
34 0.17
35 0.15
36 0.16
37 0.19
38 0.2
39 0.16
40 0.16
41 0.15
42 0.13
43 0.15
44 0.14
45 0.12
46 0.11
47 0.11
48 0.12
49 0.14
50 0.14
51 0.14
52 0.15
53 0.17
54 0.19
55 0.21
56 0.22
57 0.21
58 0.21
59 0.23
60 0.2