Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MV16

Protein Details
Accession A0A4S8MV16   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-34VNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKMQMSLKRCKHFELGGEKKTKGAALTFPMPFYAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.89
5 0.88
6 0.89
7 0.89
8 0.89
9 0.88
10 0.88
11 0.89
12 0.86
13 0.87
14 0.86
15 0.82
16 0.76
17 0.72
18 0.63
19 0.57
20 0.54
21 0.54
22 0.52
23 0.51
24 0.53
25 0.52
26 0.56
27 0.59
28 0.61
29 0.57
30 0.57
31 0.62
32 0.6
33 0.63
34 0.61
35 0.6
36 0.58
37 0.6
38 0.51
39 0.46
40 0.42
41 0.35
42 0.36
43 0.37
44 0.35
45 0.3
46 0.36
47 0.4
48 0.48
49 0.57
50 0.6
51 0.59
52 0.63
53 0.7
54 0.7
55 0.69
56 0.65
57 0.6
58 0.57
59 0.55
60 0.5
61 0.45
62 0.42
63 0.36
64 0.31
65 0.29
66 0.28
67 0.33
68 0.39
69 0.42
70 0.46
71 0.55
72 0.62
73 0.68
74 0.65
75 0.59
76 0.56
77 0.51
78 0.5
79 0.5
80 0.51
81 0.52
82 0.55
83 0.52
84 0.48
85 0.47
86 0.41
87 0.31
88 0.25
89 0.22
90 0.23
91 0.29
92 0.29
93 0.28