Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9MWQ4

Protein Details
Accession G9MWQ4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-37ISIASTPPRRAPRKVKSERDKLFDAHydrophilic
NLS Segment(s)
PositionSequence
21-27RRAPRKV
Subcellular Location(s) mito 14.5, nucl 11, cyto_mito 8.5
Family & Domain DBs
Amino Acid Sequences RSIKRPRTSASPISIASTPPRRAPRKVKSERDKLFDAIEAGADYPLEPVPIKSADDLNDVQLKKCYEILHACGSATDPNASLSKTRQSIDGFLDAVFNDWSSRKAGALPRSELDFLVEAEVVAGRLCGKPQEHTKLTDCASGSLCAVNVSAVATYCNNPPMFKLEFSTIDELSRQPEAFCPISRKDIRWVEDDWVQELRQSLRTKVIAKIHKHNKHLAIWQARKLIVEWAKGSLSLGEDVSKMGFLERETADVAIVGLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.4
3 0.39
4 0.4
5 0.37
6 0.4
7 0.49
8 0.51
9 0.59
10 0.68
11 0.71
12 0.74
13 0.81
14 0.85
15 0.85
16 0.9
17 0.88
18 0.83
19 0.77
20 0.67
21 0.58
22 0.49
23 0.4
24 0.29
25 0.23
26 0.16
27 0.13
28 0.11
29 0.09
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.1
37 0.12
38 0.12
39 0.13
40 0.15
41 0.16
42 0.2
43 0.2
44 0.2
45 0.25
46 0.25
47 0.24
48 0.26
49 0.25
50 0.22
51 0.24
52 0.22
53 0.21
54 0.24
55 0.27
56 0.28
57 0.27
58 0.26
59 0.23
60 0.23
61 0.19
62 0.17
63 0.13
64 0.09
65 0.1
66 0.11
67 0.12
68 0.12
69 0.13
70 0.18
71 0.2
72 0.2
73 0.22
74 0.22
75 0.24
76 0.26
77 0.25
78 0.2
79 0.17
80 0.17
81 0.13
82 0.13
83 0.1
84 0.08
85 0.07
86 0.07
87 0.08
88 0.09
89 0.09
90 0.08
91 0.12
92 0.18
93 0.23
94 0.26
95 0.27
96 0.27
97 0.28
98 0.28
99 0.24
100 0.2
101 0.14
102 0.11
103 0.09
104 0.08
105 0.06
106 0.06
107 0.06
108 0.04
109 0.04
110 0.03
111 0.04
112 0.04
113 0.04
114 0.07
115 0.07
116 0.11
117 0.17
118 0.24
119 0.25
120 0.28
121 0.3
122 0.32
123 0.32
124 0.31
125 0.26
126 0.2
127 0.2
128 0.17
129 0.15
130 0.11
131 0.1
132 0.08
133 0.07
134 0.06
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.05
141 0.07
142 0.08
143 0.11
144 0.11
145 0.11
146 0.12
147 0.16
148 0.17
149 0.17
150 0.18
151 0.17
152 0.19
153 0.21
154 0.23
155 0.19
156 0.17
157 0.18
158 0.16
159 0.15
160 0.15
161 0.13
162 0.1
163 0.12
164 0.16
165 0.17
166 0.19
167 0.22
168 0.22
169 0.31
170 0.33
171 0.34
172 0.38
173 0.42
174 0.43
175 0.41
176 0.41
177 0.35
178 0.37
179 0.36
180 0.29
181 0.25
182 0.22
183 0.2
184 0.2
185 0.19
186 0.22
187 0.23
188 0.23
189 0.27
190 0.31
191 0.32
192 0.36
193 0.43
194 0.44
195 0.48
196 0.57
197 0.62
198 0.66
199 0.68
200 0.69
201 0.66
202 0.63
203 0.64
204 0.62
205 0.62
206 0.6
207 0.6
208 0.57
209 0.52
210 0.48
211 0.43
212 0.42
213 0.36
214 0.35
215 0.31
216 0.29
217 0.28
218 0.28
219 0.27
220 0.2
221 0.17
222 0.14
223 0.13
224 0.11
225 0.11
226 0.12
227 0.12
228 0.11
229 0.09
230 0.09
231 0.1
232 0.09
233 0.14
234 0.14
235 0.16
236 0.17
237 0.17
238 0.16
239 0.14