Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KZ82

Protein Details
Accession A0A4S8KZ82   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
96-116TPTPAAKKRRGCPPKPKKAVVHydrophilic
NLS Segment(s)
PositionSequence
102-113KKRRGCPPKPKK
Subcellular Location(s) cyto_nucl 13.5, cyto 12, nucl 11
Family & Domain DBs
Amino Acid Sequences MDYYNQYNGFLEYPPGFTGYSEDLYSDLQSLDTSTIDLNRYDEQGFHLLRAPTVDPDLPDNPFSDFSPATNGASIFDESEPAVSAVPIPDFSAAATPTPAAKKRRGCPPKPKKAVVEAEPGTPPSTPASPIHLPKPVENFSAVIHVLKPDTITRNRGKNKVVKHDPEVCGSVHAPIDVSFEKLLDMIRVEMGLEDARQLCLDSLGWYFEGKKANKLDLYPVGLPARRNFDDSQSKMQADKPAGIFHGVLGTDMPLFPHIFLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.15
5 0.18
6 0.18
7 0.19
8 0.17
9 0.16
10 0.16
11 0.17
12 0.17
13 0.14
14 0.11
15 0.09
16 0.09
17 0.09
18 0.09
19 0.08
20 0.08
21 0.08
22 0.11
23 0.12
24 0.12
25 0.14
26 0.15
27 0.17
28 0.17
29 0.16
30 0.17
31 0.22
32 0.22
33 0.2
34 0.24
35 0.22
36 0.22
37 0.24
38 0.22
39 0.17
40 0.19
41 0.19
42 0.15
43 0.19
44 0.21
45 0.2
46 0.2
47 0.19
48 0.18
49 0.19
50 0.18
51 0.18
52 0.16
53 0.14
54 0.19
55 0.19
56 0.18
57 0.18
58 0.17
59 0.14
60 0.16
61 0.16
62 0.12
63 0.1
64 0.1
65 0.09
66 0.09
67 0.09
68 0.07
69 0.07
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.09
85 0.12
86 0.18
87 0.2
88 0.27
89 0.35
90 0.4
91 0.51
92 0.59
93 0.63
94 0.69
95 0.76
96 0.8
97 0.81
98 0.8
99 0.72
100 0.7
101 0.68
102 0.59
103 0.56
104 0.46
105 0.4
106 0.36
107 0.33
108 0.26
109 0.2
110 0.17
111 0.1
112 0.1
113 0.1
114 0.1
115 0.15
116 0.18
117 0.19
118 0.21
119 0.25
120 0.25
121 0.25
122 0.3
123 0.26
124 0.23
125 0.22
126 0.21
127 0.16
128 0.17
129 0.15
130 0.1
131 0.09
132 0.08
133 0.08
134 0.07
135 0.08
136 0.08
137 0.13
138 0.16
139 0.22
140 0.27
141 0.36
142 0.42
143 0.46
144 0.49
145 0.5
146 0.54
147 0.58
148 0.62
149 0.57
150 0.57
151 0.61
152 0.57
153 0.54
154 0.48
155 0.37
156 0.31
157 0.27
158 0.22
159 0.14
160 0.12
161 0.1
162 0.08
163 0.12
164 0.1
165 0.12
166 0.1
167 0.1
168 0.1
169 0.1
170 0.1
171 0.07
172 0.07
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.07
179 0.06
180 0.06
181 0.07
182 0.08
183 0.08
184 0.08
185 0.09
186 0.08
187 0.08
188 0.08
189 0.08
190 0.09
191 0.09
192 0.1
193 0.1
194 0.11
195 0.14
196 0.22
197 0.21
198 0.27
199 0.29
200 0.34
201 0.36
202 0.36
203 0.38
204 0.35
205 0.39
206 0.33
207 0.33
208 0.33
209 0.33
210 0.34
211 0.32
212 0.35
213 0.31
214 0.35
215 0.33
216 0.38
217 0.45
218 0.48
219 0.52
220 0.49
221 0.49
222 0.46
223 0.49
224 0.47
225 0.4
226 0.4
227 0.33
228 0.31
229 0.31
230 0.31
231 0.27
232 0.2
233 0.21
234 0.16
235 0.14
236 0.12
237 0.11
238 0.1
239 0.1
240 0.11
241 0.09
242 0.1