Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8KQF6

Protein Details
Accession A0A4S8KQF6    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPRKARRHIPKDEQKKRGPPSYFBasic
NLS Segment(s)
PositionSequence
3-17RKARRHIPKDEQKKR
Subcellular Location(s) mito 19.5, cyto_mito 11.833, nucl 4.5, cyto_nucl 4.333
Family & Domain DBs
Amino Acid Sequences MPRKARRHIPKDEQKKRGPPSYFAGAPLQLLQSNLQAYIDTHGNREAFWARFNSAWHTKYPPTMTEKEKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.83
4 0.81
5 0.73
6 0.66
7 0.62
8 0.59
9 0.51
10 0.44
11 0.38
12 0.29
13 0.26
14 0.22
15 0.17
16 0.11
17 0.11
18 0.09
19 0.09
20 0.09
21 0.08
22 0.08
23 0.07
24 0.07
25 0.08
26 0.1
27 0.09
28 0.1
29 0.13
30 0.13
31 0.13
32 0.15
33 0.17
34 0.15
35 0.17
36 0.18
37 0.17
38 0.19
39 0.2
40 0.25
41 0.28
42 0.29
43 0.3
44 0.34
45 0.34
46 0.39
47 0.41
48 0.39
49 0.39
50 0.44
51 0.49