Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KU55

Protein Details
Accession A0A4S8KU55    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
124-175NLVLSRKSRSRKSRSRKSRSRKSRSRKSRSCKSRSRKSRSCKSRSRSSHSRSHydrophilic
NLS Segment(s)
PositionSequence
129-170RKSRSRKSRSRKSRSRKSRSRKSRSCKSRSRKSRSCKSRSRS
Subcellular Location(s) plas 12, extr 8, mito 3, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTLSHHVAVFLPLVPASLEVLALPTLVLVSLVLVSLIPASSSVLASPILAALVFAYLVLASLVLAALVLAVLVPLVLTGLVPAALVVVALVLVLLVLVTLVLAALVLANLVLANLVLANLVLANLVLSRKSRSRKSRSRKSRSRKSRSRKSRSCKSRSRKSRSCKSRSRSSHSRSSRSHSSCSRNSCFAAVLVLSVHVEPKTLHFAFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.07
6 0.06
7 0.07
8 0.07
9 0.07
10 0.06
11 0.04
12 0.04
13 0.04
14 0.04
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.04
23 0.04
24 0.03
25 0.04
26 0.05
27 0.05
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.02
44 0.03
45 0.03
46 0.03
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.01
57 0.01
58 0.01
59 0.01
60 0.01
61 0.01
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.01
79 0.01
80 0.01
81 0.01
82 0.01
83 0.01
84 0.01
85 0.01
86 0.01
87 0.01
88 0.01
89 0.01
90 0.01
91 0.01
92 0.01
93 0.01
94 0.01
95 0.01
96 0.01
97 0.02
98 0.02
99 0.01
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.03
112 0.03
113 0.04
114 0.05
115 0.08
116 0.14
117 0.21
118 0.3
119 0.4
120 0.5
121 0.6
122 0.7
123 0.78
124 0.84
125 0.89
126 0.91
127 0.92
128 0.93
129 0.93
130 0.93
131 0.93
132 0.92
133 0.93
134 0.93
135 0.93
136 0.93
137 0.91
138 0.91
139 0.91
140 0.9
141 0.9
142 0.89
143 0.89
144 0.89
145 0.9
146 0.89
147 0.88
148 0.89
149 0.89
150 0.89
151 0.88
152 0.84
153 0.85
154 0.84
155 0.83
156 0.83
157 0.79
158 0.8
159 0.78
160 0.79
161 0.73
162 0.72
163 0.73
164 0.67
165 0.69
166 0.66
167 0.66
168 0.65
169 0.69
170 0.66
171 0.6
172 0.57
173 0.51
174 0.43
175 0.35
176 0.3
177 0.21
178 0.16
179 0.12
180 0.11
181 0.1
182 0.09
183 0.11
184 0.09
185 0.1
186 0.1
187 0.13
188 0.21