Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V4HEC2

Protein Details
Accession A0A4V4HEC2   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
111-146ESPEPKPTPSAKKTKKSKGKTRRTKRKSTGKPKQGRBasic
NLS Segment(s)
PositionSequence
112-146SPEPKPTPSAKKTKKSKGKTRRTKRKSTGKPKQGR
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 4, cyto 2.5, plas 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSSPSRDARLPQNDDEDEDEQVTRLTDANNSTESTGSSPLKRTLWMVVIGLMLLFASNSLYSNWIRPRKPQILHAQRYSKEYKFRPAASPIITESLKDGRLRVRGAGPTESPEPKPTPSAKKTKKSKGKTRRTKRKSTGKPKQGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.49
4 0.41
5 0.32
6 0.28
7 0.24
8 0.17
9 0.17
10 0.15
11 0.1
12 0.09
13 0.09
14 0.11
15 0.12
16 0.15
17 0.16
18 0.16
19 0.16
20 0.16
21 0.16
22 0.14
23 0.17
24 0.17
25 0.18
26 0.2
27 0.23
28 0.23
29 0.23
30 0.23
31 0.2
32 0.2
33 0.19
34 0.17
35 0.14
36 0.13
37 0.12
38 0.1
39 0.07
40 0.05
41 0.03
42 0.03
43 0.02
44 0.02
45 0.03
46 0.04
47 0.04
48 0.07
49 0.07
50 0.12
51 0.19
52 0.25
53 0.26
54 0.31
55 0.39
56 0.44
57 0.46
58 0.48
59 0.52
60 0.56
61 0.6
62 0.61
63 0.59
64 0.52
65 0.55
66 0.53
67 0.45
68 0.42
69 0.4
70 0.42
71 0.41
72 0.42
73 0.41
74 0.4
75 0.41
76 0.35
77 0.34
78 0.27
79 0.26
80 0.23
81 0.2
82 0.18
83 0.17
84 0.17
85 0.16
86 0.17
87 0.17
88 0.21
89 0.23
90 0.23
91 0.24
92 0.26
93 0.28
94 0.3
95 0.26
96 0.26
97 0.3
98 0.31
99 0.28
100 0.29
101 0.29
102 0.27
103 0.32
104 0.35
105 0.4
106 0.45
107 0.55
108 0.6
109 0.68
110 0.77
111 0.82
112 0.86
113 0.87
114 0.9
115 0.9
116 0.91
117 0.93
118 0.94
119 0.95
120 0.93
121 0.94
122 0.93
123 0.93
124 0.93
125 0.94
126 0.93