Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8LG39

Protein Details
Accession A0A4S8LG39    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-77VLGYTPRKRHPRVNKHQCCQSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.333, mito 13, nucl 11.5, cyto_nucl 7.666
Family & Domain DBs
Amino Acid Sequences MSGNPLYARNMLNPLNMFRVASKIYRMSDLDNTGPVELSRLRSLIEVEKKIRPLAVLGYTPRKRHPRVNKHQCCQSTWRKPFWNVEACASLPGKVLLMDSMNGAKRHWVGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.27
4 0.25
5 0.2
6 0.22
7 0.2
8 0.2
9 0.21
10 0.22
11 0.22
12 0.25
13 0.26
14 0.26
15 0.27
16 0.29
17 0.26
18 0.23
19 0.23
20 0.2
21 0.19
22 0.15
23 0.13
24 0.11
25 0.13
26 0.12
27 0.12
28 0.12
29 0.12
30 0.14
31 0.19
32 0.23
33 0.24
34 0.26
35 0.29
36 0.29
37 0.29
38 0.28
39 0.21
40 0.16
41 0.14
42 0.13
43 0.12
44 0.13
45 0.22
46 0.25
47 0.27
48 0.33
49 0.38
50 0.4
51 0.48
52 0.57
53 0.59
54 0.68
55 0.78
56 0.81
57 0.79
58 0.84
59 0.76
60 0.69
61 0.66
62 0.65
63 0.65
64 0.61
65 0.63
66 0.61
67 0.63
68 0.66
69 0.66
70 0.63
71 0.54
72 0.51
73 0.46
74 0.4
75 0.39
76 0.33
77 0.26
78 0.18
79 0.16
80 0.13
81 0.11
82 0.11
83 0.09
84 0.09
85 0.09
86 0.1
87 0.15
88 0.19
89 0.19
90 0.19
91 0.22