Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KQ53

Protein Details
Accession A0A4S8KQ53    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
50-76EGRLKKAVKRKEKEKTKSKKSWDERKEBasic
93-118IAMRNERRNDKRKGVKTKNKARPGFEBasic
NLS Segment(s)
PositionSequence
45-138KVKDDEGRLKKAVKRKEKEKTKSKKSWDERKEHLAASMAAKQKKRADNIAMRNERRNDKRKGVKTKNKARPGFEGKAFGKGKAKAGGGKGPKGK
Subcellular Location(s) nucl 14, mito 12, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029190  Rrp14/SURF6_C  
IPR007019  SURF6  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04935  SURF6  
Amino Acid Sequences SNPTQALSQLAARKEKLAALPEEKRKAIEEREQFEKAEARLEGVKVKDDEGRLKKAVKRKEKEKTKSKKSWDERKEHLAASMAAKQKKRADNIAMRNERRNDKRKGVKTKNKARPGFEGKAFGKGKAKAGGGKGPKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.29
4 0.29
5 0.3
6 0.33
7 0.4
8 0.47
9 0.51
10 0.49
11 0.46
12 0.44
13 0.44
14 0.43
15 0.44
16 0.43
17 0.42
18 0.48
19 0.48
20 0.45
21 0.42
22 0.4
23 0.31
24 0.27
25 0.22
26 0.18
27 0.18
28 0.19
29 0.2
30 0.17
31 0.2
32 0.16
33 0.18
34 0.19
35 0.19
36 0.27
37 0.27
38 0.31
39 0.3
40 0.34
41 0.37
42 0.42
43 0.49
44 0.51
45 0.54
46 0.59
47 0.68
48 0.74
49 0.79
50 0.83
51 0.84
52 0.84
53 0.84
54 0.83
55 0.83
56 0.81
57 0.83
58 0.8
59 0.76
60 0.7
61 0.69
62 0.63
63 0.53
64 0.44
65 0.35
66 0.28
67 0.24
68 0.25
69 0.23
70 0.25
71 0.25
72 0.29
73 0.35
74 0.39
75 0.4
76 0.4
77 0.43
78 0.48
79 0.56
80 0.62
81 0.63
82 0.61
83 0.64
84 0.64
85 0.65
86 0.65
87 0.64
88 0.61
89 0.63
90 0.71
91 0.74
92 0.8
93 0.82
94 0.84
95 0.87
96 0.9
97 0.91
98 0.91
99 0.86
100 0.8
101 0.78
102 0.76
103 0.72
104 0.65
105 0.63
106 0.53
107 0.57
108 0.54
109 0.47
110 0.45
111 0.41
112 0.43
113 0.4
114 0.41
115 0.37
116 0.4
117 0.46
118 0.45