Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MH18

Protein Details
Accession A0A4S8MH18    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
211-235MLAITDKKKRDKHLLEKTKMRRTWQHydrophilic
NLS Segment(s)
PositionSequence
154-156RKP
218-222KKRDK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.333, cyto 6, cyto_mito 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR035992  Ricin_B-like_lectins  
Amino Acid Sequences MSTAAHTNGFPEGYFVIRSAATGRIWDVSSDSKDDGTEIILWPEKDTSLVDGRRNKSAENQVFFIDTSGALCSRDSGHAVDIEGDKLVLRHRRPVISPYPNSYSHPPAKFVFSKESGGEIQIQFEFDPSYPPPSAAPSEAWKEKTFLLTAIPKRKPKGKMLSSLFGGSHSSTADDLAKSGIDLADNEILDEDLGEEGEVDDSPDTGRDIRMLAITDKKKRDKHLLEKTKMRRTWQIIKLRNSDARTGKFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.12
5 0.12
6 0.13
7 0.15
8 0.13
9 0.14
10 0.15
11 0.16
12 0.16
13 0.16
14 0.17
15 0.19
16 0.21
17 0.23
18 0.22
19 0.2
20 0.2
21 0.2
22 0.17
23 0.14
24 0.13
25 0.1
26 0.13
27 0.15
28 0.16
29 0.16
30 0.16
31 0.15
32 0.14
33 0.14
34 0.15
35 0.19
36 0.23
37 0.29
38 0.37
39 0.39
40 0.45
41 0.45
42 0.42
43 0.42
44 0.49
45 0.5
46 0.45
47 0.44
48 0.38
49 0.38
50 0.37
51 0.3
52 0.19
53 0.12
54 0.09
55 0.08
56 0.08
57 0.07
58 0.07
59 0.08
60 0.09
61 0.1
62 0.11
63 0.11
64 0.11
65 0.12
66 0.12
67 0.13
68 0.12
69 0.11
70 0.09
71 0.08
72 0.07
73 0.07
74 0.12
75 0.16
76 0.17
77 0.24
78 0.28
79 0.31
80 0.32
81 0.38
82 0.43
83 0.45
84 0.46
85 0.44
86 0.45
87 0.43
88 0.44
89 0.42
90 0.39
91 0.37
92 0.36
93 0.34
94 0.3
95 0.34
96 0.33
97 0.32
98 0.3
99 0.25
100 0.26
101 0.23
102 0.24
103 0.2
104 0.18
105 0.19
106 0.14
107 0.13
108 0.11
109 0.11
110 0.09
111 0.09
112 0.09
113 0.06
114 0.08
115 0.08
116 0.11
117 0.11
118 0.12
119 0.12
120 0.13
121 0.14
122 0.13
123 0.14
124 0.13
125 0.18
126 0.2
127 0.22
128 0.21
129 0.21
130 0.2
131 0.21
132 0.18
133 0.14
134 0.15
135 0.19
136 0.25
137 0.33
138 0.38
139 0.41
140 0.44
141 0.51
142 0.53
143 0.55
144 0.59
145 0.56
146 0.59
147 0.6
148 0.61
149 0.55
150 0.51
151 0.42
152 0.32
153 0.28
154 0.18
155 0.14
156 0.1
157 0.09
158 0.08
159 0.09
160 0.1
161 0.08
162 0.08
163 0.08
164 0.08
165 0.07
166 0.07
167 0.06
168 0.05
169 0.06
170 0.08
171 0.1
172 0.1
173 0.1
174 0.1
175 0.09
176 0.09
177 0.08
178 0.06
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.06
190 0.06
191 0.07
192 0.08
193 0.08
194 0.08
195 0.09
196 0.1
197 0.12
198 0.13
199 0.15
200 0.23
201 0.3
202 0.38
203 0.46
204 0.54
205 0.58
206 0.63
207 0.71
208 0.72
209 0.76
210 0.79
211 0.82
212 0.82
213 0.86
214 0.89
215 0.88
216 0.82
217 0.77
218 0.75
219 0.72
220 0.74
221 0.73
222 0.74
223 0.72
224 0.76
225 0.77
226 0.75
227 0.74
228 0.67
229 0.66
230 0.64
231 0.61