Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8M357

Protein Details
Accession A0A4S8M357    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-68LGRSRGKHKRRRILEFERREEBasic
NLS Segment(s)
PositionSequence
50-59RSRGKHKRRR
Subcellular Location(s) nucl 13cyto_nucl 13, cyto 11
Family & Domain DBs
Amino Acid Sequences TYEGRFDVQSRRGSVDVALVDRGSSSHHSGLGSGITSVTPCASTSGDLGRSRGKHKRRRILEFERREETRISGWVNVSGEDEGKFRGEVEIVTSMVEASLHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.25
4 0.21
5 0.19
6 0.15
7 0.14
8 0.13
9 0.13
10 0.11
11 0.12
12 0.14
13 0.14
14 0.15
15 0.16
16 0.16
17 0.16
18 0.14
19 0.11
20 0.08
21 0.07
22 0.06
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.06
29 0.07
30 0.07
31 0.08
32 0.1
33 0.14
34 0.14
35 0.15
36 0.17
37 0.19
38 0.24
39 0.31
40 0.39
41 0.44
42 0.54
43 0.62
44 0.66
45 0.73
46 0.77
47 0.8
48 0.81
49 0.8
50 0.76
51 0.72
52 0.65
53 0.58
54 0.5
55 0.41
56 0.32
57 0.27
58 0.22
59 0.19
60 0.19
61 0.2
62 0.19
63 0.18
64 0.17
65 0.15
66 0.14
67 0.13
68 0.13
69 0.1
70 0.11
71 0.11
72 0.1
73 0.1
74 0.1
75 0.09
76 0.12
77 0.13
78 0.12
79 0.12
80 0.12
81 0.11
82 0.1