Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KNB1

Protein Details
Accession A0A4S8KNB1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28KQLTTPNAPVKPKRKKTHRLSDLRPIPLHydrophilic
NLS Segment(s)
PositionSequence
11-16KPKRKK
Subcellular Location(s) nucl 19, cyto_nucl 13, mito 5
Family & Domain DBs
Amino Acid Sequences KQLTTPNAPVKPKRKKTHRLSDLRPIPLSIPSTLATGTGNESQDVTSPTDAGGEVQPLINSPFDFSFGDELLYPSSPYPDTISDTAKSPVQAQYVYDEET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.9
4 0.92
5 0.92
6 0.91
7 0.87
8 0.87
9 0.84
10 0.78
11 0.68
12 0.57
13 0.47
14 0.41
15 0.36
16 0.26
17 0.2
18 0.16
19 0.16
20 0.15
21 0.14
22 0.11
23 0.09
24 0.11
25 0.12
26 0.11
27 0.11
28 0.11
29 0.11
30 0.12
31 0.13
32 0.11
33 0.09
34 0.08
35 0.08
36 0.08
37 0.08
38 0.07
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.07
46 0.06
47 0.06
48 0.07
49 0.07
50 0.09
51 0.1
52 0.1
53 0.11
54 0.1
55 0.11
56 0.1
57 0.11
58 0.1
59 0.1
60 0.1
61 0.08
62 0.1
63 0.1
64 0.11
65 0.13
66 0.13
67 0.18
68 0.19
69 0.23
70 0.22
71 0.24
72 0.25
73 0.24
74 0.23
75 0.21
76 0.23
77 0.22
78 0.22
79 0.21
80 0.24