Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8MF05

Protein Details
Accession A0A4S8MF05    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
130-155LVAFGRRIMRKRVRSKKKGSSHSSEGHydrophilic
NLS Segment(s)
PositionSequence
135-148RRIMRKRVRSKKKG
Subcellular Location(s) nucl 8, mito 8, mito_nucl 8, extr 6
Family & Domain DBs
Amino Acid Sequences MATPAVPPNLLAYCQLLHSELRRLHDCLDLLQFGKDASSTPTGHSWRLGAQPPLDFSTPGPSYSADTPAPTPTTHTIGHISVPLAQTHSTAEGKPDRYSCTLVAFTLKSGQSGERHVTIRGTDTQIGEALVAFGRRIMRKRVRSKKKGSSHSSEGTTAPPLANPPVGVQSREHQWTRRFIEAYRSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.15
5 0.17
6 0.24
7 0.25
8 0.3
9 0.33
10 0.34
11 0.34
12 0.36
13 0.34
14 0.29
15 0.29
16 0.25
17 0.22
18 0.21
19 0.19
20 0.15
21 0.14
22 0.11
23 0.09
24 0.1
25 0.14
26 0.14
27 0.16
28 0.22
29 0.24
30 0.25
31 0.25
32 0.23
33 0.21
34 0.26
35 0.28
36 0.24
37 0.24
38 0.24
39 0.25
40 0.27
41 0.25
42 0.2
43 0.17
44 0.21
45 0.2
46 0.19
47 0.18
48 0.15
49 0.17
50 0.18
51 0.21
52 0.14
53 0.15
54 0.15
55 0.16
56 0.17
57 0.14
58 0.16
59 0.15
60 0.18
61 0.17
62 0.18
63 0.18
64 0.17
65 0.18
66 0.15
67 0.13
68 0.12
69 0.12
70 0.11
71 0.1
72 0.1
73 0.1
74 0.09
75 0.11
76 0.1
77 0.09
78 0.12
79 0.15
80 0.16
81 0.18
82 0.18
83 0.19
84 0.2
85 0.22
86 0.19
87 0.18
88 0.17
89 0.16
90 0.16
91 0.14
92 0.12
93 0.14
94 0.14
95 0.11
96 0.12
97 0.14
98 0.13
99 0.16
100 0.18
101 0.17
102 0.18
103 0.18
104 0.18
105 0.17
106 0.18
107 0.18
108 0.19
109 0.17
110 0.17
111 0.17
112 0.16
113 0.16
114 0.13
115 0.1
116 0.07
117 0.06
118 0.06
119 0.05
120 0.06
121 0.1
122 0.14
123 0.17
124 0.26
125 0.35
126 0.45
127 0.57
128 0.66
129 0.74
130 0.81
131 0.88
132 0.89
133 0.89
134 0.9
135 0.86
136 0.84
137 0.8
138 0.75
139 0.68
140 0.59
141 0.5
142 0.41
143 0.36
144 0.28
145 0.21
146 0.16
147 0.15
148 0.16
149 0.16
150 0.14
151 0.14
152 0.2
153 0.22
154 0.23
155 0.23
156 0.25
157 0.31
158 0.37
159 0.39
160 0.39
161 0.43
162 0.51
163 0.54
164 0.57
165 0.53
166 0.48