Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LG92

Protein Details
Accession A0A4S8LG92   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
130-156EEEYKRAKAIKKLKRTCRKAKLLSSVSHydrophilic
NLS Segment(s)
PositionSequence
135-144RAKAIKKLKR
Subcellular Location(s) nucl 18, mito 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MHLGINHVCSECSPSLISTTPATLLCARLQQTVSKYHFPSLRKLQLSSSFPIDSFVDTMTHLASSPIECIEMQCYEDDTVDACKRLKKFIALRMVKLPKGRFFENLQRIDFVAVQDLDLPWARDLEEEEEEEYKRAKAIKKLKRTCRKAKLLSSVSEATFSRELVELDLDQREQVYASTNFPLPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.19
4 0.21
5 0.16
6 0.17
7 0.16
8 0.16
9 0.18
10 0.16
11 0.17
12 0.16
13 0.2
14 0.21
15 0.22
16 0.23
17 0.25
18 0.26
19 0.33
20 0.36
21 0.38
22 0.38
23 0.4
24 0.44
25 0.41
26 0.47
27 0.48
28 0.52
29 0.48
30 0.48
31 0.47
32 0.49
33 0.51
34 0.45
35 0.4
36 0.32
37 0.29
38 0.3
39 0.26
40 0.19
41 0.15
42 0.14
43 0.1
44 0.09
45 0.1
46 0.08
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.08
58 0.08
59 0.09
60 0.08
61 0.09
62 0.09
63 0.09
64 0.08
65 0.07
66 0.1
67 0.1
68 0.12
69 0.11
70 0.15
71 0.15
72 0.18
73 0.19
74 0.22
75 0.27
76 0.32
77 0.41
78 0.39
79 0.4
80 0.46
81 0.47
82 0.43
83 0.42
84 0.37
85 0.32
86 0.35
87 0.34
88 0.29
89 0.31
90 0.39
91 0.43
92 0.44
93 0.39
94 0.35
95 0.34
96 0.32
97 0.28
98 0.19
99 0.13
100 0.1
101 0.09
102 0.09
103 0.08
104 0.09
105 0.09
106 0.09
107 0.07
108 0.07
109 0.08
110 0.07
111 0.09
112 0.11
113 0.12
114 0.12
115 0.13
116 0.15
117 0.15
118 0.15
119 0.15
120 0.11
121 0.12
122 0.16
123 0.19
124 0.27
125 0.37
126 0.46
127 0.56
128 0.66
129 0.75
130 0.81
131 0.87
132 0.89
133 0.89
134 0.89
135 0.87
136 0.86
137 0.85
138 0.79
139 0.72
140 0.67
141 0.59
142 0.49
143 0.43
144 0.35
145 0.29
146 0.25
147 0.22
148 0.18
149 0.16
150 0.16
151 0.14
152 0.17
153 0.13
154 0.14
155 0.16
156 0.15
157 0.14
158 0.14
159 0.13
160 0.11
161 0.1
162 0.14
163 0.14
164 0.16
165 0.2