Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N1W3

Protein Details
Accession G9N1W3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
98-129GDVKYKAYTRALRRRPPRRREHKELQPCTPDVHydrophilic
NLS Segment(s)
PositionSequence
108-119ALRRRPPRRREH
Subcellular Location(s) nucl 10, cyto_nucl 8.5, mito 8, cyto 5, pero 3
Family & Domain DBs
Amino Acid Sequences MPRNRDFFDSEIRAPHWWTPDLTPTFALRAAAITRTWFGIGQGSTAPAAPGGIGGQERYLRWWWQLAADGGTTAIKEYRLVPLAHHHQWAGEAIPRTGDVKYKAYTRALRRRPPRRREHKELQPCTPDVQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.3
4 0.27
5 0.27
6 0.26
7 0.32
8 0.33
9 0.32
10 0.3
11 0.27
12 0.26
13 0.25
14 0.23
15 0.14
16 0.13
17 0.13
18 0.12
19 0.11
20 0.11
21 0.11
22 0.11
23 0.12
24 0.1
25 0.09
26 0.12
27 0.11
28 0.11
29 0.11
30 0.11
31 0.1
32 0.1
33 0.1
34 0.05
35 0.05
36 0.04
37 0.04
38 0.03
39 0.04
40 0.04
41 0.04
42 0.05
43 0.07
44 0.07
45 0.09
46 0.11
47 0.11
48 0.12
49 0.13
50 0.12
51 0.12
52 0.14
53 0.12
54 0.11
55 0.1
56 0.09
57 0.08
58 0.07
59 0.06
60 0.05
61 0.05
62 0.04
63 0.05
64 0.06
65 0.09
66 0.11
67 0.12
68 0.12
69 0.19
70 0.25
71 0.27
72 0.27
73 0.24
74 0.21
75 0.22
76 0.22
77 0.16
78 0.14
79 0.13
80 0.12
81 0.13
82 0.13
83 0.14
84 0.14
85 0.16
86 0.16
87 0.19
88 0.21
89 0.24
90 0.27
91 0.33
92 0.4
93 0.46
94 0.53
95 0.59
96 0.67
97 0.74
98 0.82
99 0.86
100 0.89
101 0.9
102 0.9
103 0.91
104 0.91
105 0.91
106 0.91
107 0.91
108 0.88
109 0.85
110 0.8
111 0.72